Computational Time for obspectrophore in Open Babel?
0
0
Entering edit mode
8.2 years ago
dxu108 • 0

I apologize in advance if this question is naive/simple. I am currently running the Open Babel command obspectrophore as follows:

obspectrophore -i tester.sdf

where tester.sdf is an SDF file generated from the following FASTA sequence:

MDAATTRVGLTDLTFRLLRESFADAVSWVAKNLPARPAVPVLSGVLLTGSDNGLTISGFDYEVSAEAQVG

Running the command above took 5+ minutes to complete. Is this normal or is there some way (using a different file format/modifying settings) that I can obtain faster spectrophore results?

Thanks in advance!

feature extraction spectrophore open babel • 1.4k views
ADD COMMENT
0
Entering edit mode

"On a personal computer equipped with an i7-5500U processor with 12 GB of main memory, the Open Babel version runs fastest, with an average calculation speed of 36 ± 2 ms/molecule." https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5842169/ This is most likely the speed with small molecule not large ones.

ADD REPLY

Login before adding your answer.

Traffic: 1567 users visited in the last hour
Help About
FAQ
Access RSS
API
Stats

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.

Powered by the version 2.3.6