Hi Everyone
I have a question which might be a simple one for you guys So since i am working on ribosomal protein genes(around 80 in humans), i have managed to extract the snps at various locations in all those 80 genes. These snps are basically genomic in origin and they are coding. I will just show you guys the table.
#bin chrom chromStart chromEnd name transcript frame alleleCount funcCodes alleles codons peptides mol_type class function
887 chr22 39708987 39708988 rs2014840 NM_000967 2 2 8,42, G,T, GGA,GTA, G,V, genomic single missense
Now as you can see their is a change of peptide from G(glycine) -> V(valine) for snp rs2014840.
What i am interested in is the fact that i need to find where this change is actually occurring in the peptide seq. In other words i want to know which Glycine(G) residue gets changed to Valine(V).
I am making my question more clear.
Now suppose i have a seq of Amino Acids
MACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQ
PYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCR
GGRMFA
Now what i want to know is which G(glycine) in the above seq is changing into V(valine)
I have a huge list of my genes and each genes have snps like these.
It would be very nice of you to help me out in this..
Regards
