Question: Maker produces duplicate mRNA sequence with different AED score, what is up with that?
0
gravatar for Lesley Sitter
5.8 years ago by
Lesley Sitter540
Netherlands
Lesley Sitter540 wrote:

Hopefully someone can help me find out what is happening.
I have used maker for a while now to annotate several genomes but this week i got something weird.

Maker made two mRNA predictions out of 1 gene (which normally means it's a splice variant or something like that) but this time the sequences are identical but it still puts it under two different names with two different AED scores.

Below are the two proteins this has happened to. Can someone shed some light on what has happened here? I would really appreciate it :D

With kind regards

 

>maker-SL2.40sc04057-exonerate_est2genome-gene-146.0-mRNA-1 protein AED:0.29 eAED:0.29 QI:167|1|1|1|0|0|4|279|99
MEMGSFFSVLIGEQFQEFGSLFSAKYNTNGNLLPPNFINVVGCLYGIGDMESLCEPGKRE
SLHCYKLGPKQWVAEVQFLGVVDHPNLDKLEYCDVGLFA
>maker-SL2.40sc04057-exonerate_est2genome-gene-146.0-mRNA-2 protein AED:0.31 eAED:0.31 QI:167|1|1|1|0|0|3|214|99
MEMGSFFSVLIGEQFQEFGSLFSAKYNTNGNLLPPNFINVVGCLYGIGDMESLCEPGKRE
SLHCYKLGPKQWVAEVQFLGVVDHPNLDKLEYCDVGLFA

>maker-SL2.40sc04135-exonerate_est2genome-gene-17.5-mRNA-1 protein AED:0.03 eAED:0.03 QI:141|1|1|1|0|0|3|232|168
MEIMLNNTVLTCASTLLPSTQDGVPLLAIETKVEGDQNTNDEQTKVVDADEEGGDGDDND
ENGNEGFEEGEEEYSDEGVHGNKSKGNAKKSNGEGEENGDAEDEEDVGEEGHDDDGDDDD
DGDDDNDDDEEAEEGEGEEEVVEDDDPEDDDEEDEEEEAIQPPKKRKK
>maker-SL2.40sc04135-exonerate_est2genome-gene-17.5-mRNA-2 protein AED:0.06 eAED:0.06 QI:92|1|1|1|0|0|2|232|168
MEIMLNNTVLTCASTLLPSTQDGVPLLAIETKVEGDQNTNDEQTKVVDADEEGGDGDDND
ENGNEGFEEGEEEYSDEGVHGNKSKGNAKKSNGEGEENGDAEDEEDVGEEGHDDDGDDDD
DGDDDNDDDEEAEEGEGEEEVVEDDDPEDDDEEDEEEEAIQPPKKRKK

maker-p proteins maker duplicate • 2.2k views
ADD COMMENTlink modified 5.2 years ago • written 5.8 years ago by Lesley Sitter540
1
gravatar for Lesley Sitter
5.5 years ago by
Lesley Sitter540
Netherlands
Lesley Sitter540 wrote:

Figured it out :P

It seems that MAKER creates two gene models that are mostly identical except for the UTR, which isn't translated into the protein model off-course. Therefore you get two identical protein models but the gene models are slightly different (although not much).

ADD COMMENTlink written 5.5 years ago by Lesley Sitter540
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1012 users visited in the last hour