Question: (Closed) similarety search for homologous alignment
0
gravatar for shoxan-rahman
4.3 years ago by
Sweden
shoxan-rahman0 wrote:

by using blastp, and the E < 10‐50 as threshold for homology, how many

homologs do you find in Swissprot? From which species are the five closest homologs? (If

there are less than five, then state species names for all. If there are none, try selecting a

different sequence.) How do the results change if you search in the non‐redundant protein

database instead of in Swissprot, and why? my sequence is

  
>sp|Q42525|HXK1_ARATH Hexokinase-1 OS=Arabidopsis thaliana GN=HXK1 PE=1 SV=2
MGKVAVGATVVCTAAVCAVAVLVVRRRMQSSGKWGRVLAILKAFEEDCATPISKLRQVAD
AMTVEMHAGLASDGGSKLKMLISYVDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQER
VVKQEFEEVSIPPHLMTGGSDELFNFIAEALAKFVATECEDFHLPEGRQRELGFTFSFPV
KQTSLSSGSLIKWTKGFSIEEAVGQDVVGALNKALERVGLDMRIAALVNDTVGTLAGGRY
YNPDVVAAVILGTGTNAAYVERATAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEFDH
TLDFESLNPGEQILEKIISGMYLGEILRRVLLKMAEDAAFFGDTVPSKLRIPFIIRTPHM
SAMHNDTSPDLKIVGSKIKDILEVPTTSLKMRKVVISLCNIIATRGARLSAAGIYGILKK
LGRDTTKDEEVQKSVIAMDGGLFEHYTQFSECMESSLKELLGDEASGSVEVTHSNDGSGI
GAALLAASHSLYLEDS

alignment • 916 views
ADD COMMENTlink written 4.3 years ago by shoxan-rahman0

Hello shoxan-rahman!

We believe that this post does not fit the main topic of this site.

We will not do your assignment for you.

For this reason we have closed your question. This allows us to keep the site focused on the topics that the community can help with.

If you disagree please tell us why in a reply below, we'll be happy to talk about it.

Cheers!

ADD REPLYlink modified 4.3 years ago • written 4.3 years ago by RamRS21k
Please log in to add an answer.
The thread is closed. No new answers may be added.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1807 users visited in the last hour