Question: I need help for a command that I wrote in perl
0
gravatar for mark2020
15 months ago by
mark20200
mark20200 wrote:

I wanna extract the header line from 2 protein sequences for example: I created the file, then I gave the file name, then I wanna extract header, then from the second sequence.

here I showed what's the header in below:

gi|628601924|ref|NP_001278775.1| DNA-binding protein Ikaros isoform 16 [Homo sapiens] These are my protein fasta with heder that i wanna extract the header from them:

gi|628601924|ref|NP_001278775.1| DNA-binding protein Ikaros isoform 16 [Homo sapiens] MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVVTYGADDFRDFHAIIPK SFSLLEL

gi|628601926|ref|NP_001278776.1| DNA-binding protein Ikaros isoform 16 [Homo sapiens] MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVVTYGADDFRDFHAIIPK SFSLLEL

I wrote this command:

   print "Please enter a file name: ";
   $file = <>;
   open INFILE, $file;

   $line = <INFILE>;

   while (defined($line = <INFILE>)){
   }
   chomp $line;

if ($line =~ /^>(S+)\s*(.*)$/;){

 $id = $1; # what should I write here to activate these $1 and $2

 $description = $2;

   print substr($1 $2); #what else should I add here
   }

   } else {# I need to write some thing here, like this it's not header don't  extract it 

   }
   next; # is this enough for going to the next sequence 

   close INFILE;
software error • 628 views
ADD COMMENTlink modified 15 months ago by geek_y8.2k • written 15 months ago by mark20200
2

If you just need the header line then you could grep ">" .. no need for PERL.

ADD REPLYlink written 15 months ago by genomax40k
1

Why only perl? Is this homework? BTW, this was answered many a times in this forum.

ADD REPLYlink written 15 months ago by venu4.7k
1

This sounds suspiciously homework-y.

ADD REPLYlink written 15 months ago by Chris Fields1.8k

thanks for your comments I edited my question.

ADD REPLYlink written 15 months ago by mark20200

Please use ADD REPLY/ADD COMMENT when responding to existing posts to keep threads logically organized.

The original question is still unanswered. Is this a homework question?

Hint: If you just need to print the header line then check to see if the line begins with "^>" otherwise go to next line.

ADD REPLYlink modified 15 months ago • written 15 months ago by genomax40k
0
gravatar for Eric Lim
15 months ago by
Eric Lim370
Stoke Therapeutics, Inc
Eric Lim370 wrote:

Google 'perl grep command line'.

ADD COMMENTlink modified 15 months ago • written 15 months ago by Eric Lim370
3

When a question is suspiciously specific (e.g. need PERL solution) we try to encourage the OP to research a solution on their own (unless they provide an explanation that makes a compelling case). It is not helpful to provide a ready solution, especially if this is part of a homework assignment.

ADD REPLYlink modified 15 months ago • written 15 months ago by genomax40k
1

I know, but it's Friday and I want to be nice. Answer changed.

ADD REPLYlink written 15 months ago by Eric Lim370
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 991 users visited in the last hour