Question: (Closed) Is there any software/online tools to find N terminal and C terminal of a protein
0
gravatar for Naresh
2.4 years ago by
Naresh60
Korea, Republic Of
Naresh60 wrote:

Hi.

I am interested to find N terminal and C terminal of a protein using online tools for my designing experiments.

sequence genome • 1.9k views
ADD COMMENTlink written 2.4 years ago by Naresh60
1

What sort of input do you have...

ADD REPLYlink written 2.4 years ago by Devon Ryan88k

Hello Naresh!

Questions similar to yours can already be found at:

We have closed your question to allow us to keep similar content in the same thread.

If you disagree with this please tell us why in a reply below. We'll be happy to talk about it.

Cheers!

ADD REPLYlink written 2.4 years ago by Pierre Lindenbaum118k

I strongly disagree. I am asking questions in Biostars because you people are more experienced and have vast knowledge. You need to answer or give convincing answers to me rather than closing if you find similar question before.

ADD REPLYlink written 2.4 years ago by Naresh60
1

You need to give enough information for us to answer the questions. You've asked this same question before and gotten replies asking for additional context, so provide that.

ADD REPLYlink written 2.4 years ago by Devon Ryan88k

suppose i have a FAM72A protein of 149 aa. I know from where N terminal starts, but i don't know where N terminal ends and also i don't know from where C terminal starts and ends in that protein. Please let me know.

ADD REPLYlink written 2.4 years ago by Naresh60
1

Dude, you are confused. May be first you get your question right. Protein is made by reading mRNA in the 5' to 3' direction and making new protein from its amino end (N-terminus) towards its carboxyl end (C-terminus). so In your case, 1st amino acid would have N terminal and 149th would have C-terminal. I think that wikipedia would be more helpful for you than biostar

ADD REPLYlink written 2.4 years ago by Manvendra Singh2.0k

Please consult an undergraduate biology text book. A basic understanding of biological terms will go a long way.

ADD REPLYlink written 2.4 years ago by Devon Ryan88k

MFKCWSVVLVLGFIFLESEGRPTKEGGYGLKSYQPLMRLRHKQEKNQESSRVKGFMIQDGPFGSCE NKYCGLGRHCVTSRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVHRAACLKKQKITIVHNED CFFKGDKCKTTEYSKMKNMLLDLQNQKYIMQENENPNGDDISRKKLLVDQMFKYFDADSNGLVDIN ELTQVIKQEELGKDLFDCTLYVLLKYDDFNADKHLALEEFYRAFQVIQLSLPEDQKLSITAATVGQ SAVLSCAIQGTLRPPIIWKRNNIILNNLDLEDINDFGDDGSLYITKVTTTHVGNYTCYADGYEQVY QTHIFQVNVPPVIRVYPESQAREPGVTASLRCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGS EVHISNVRYEDTGAYTCIAKNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGI KVIQPIECEFQRHIKPSEKLLGFQDEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVD VQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQ FDRVDDFFIPTTTLIITHMRFGFILHKDEAALQKIDLETMSYIKTINLKDYKCVPQSLAYTHLGGY YFIGCKPDSTGAVSPQVMVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDVKGLVRVQYITIRGE IQEAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKMIKSLKEPLKAEEWP WNRKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGDA

ADD REPLYlink written 22 months ago by fekealex0

okayyyyyy... PEPTIDE ! Am I right ? DID I WIN SOMETHING ?!!!

ADD REPLYlink written 22 months ago by Pierre Lindenbaum118k

Follistatin-related protein 5. I award myself one internet.

ADD REPLYlink modified 22 months ago • written 22 months ago by Devon Ryan88k
Please log in to add an answer.
The thread is closed. No new answers may be added.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1796 users visited in the last hour