Question: GEN CLUSTERIN question
0
gravatar for cristina_sabiers
2.5 years ago by
Spain
cristina_sabiers60 wrote:

Im helping a friend who is studing the clusterin gen

http://www.ensembl.org/Homo_sapiens/Gene/Summary?db=core;g=ENSG00000120885;r=8:27596917-27615031;t=ENST00000316403

We have a question, when we check the CLU-001 CLU-003 CLU 004 they have different length but when we look at the amino acid that codify, all are the same in the three cases (CLU-001 003 004) if look down at ensembl

http://www.ensembl.org/Homo_sapiens/Transcript/Sequence_Protein?db=core;g=ENSG00000120885;r=8:27596917-27615031;t=ENST00000405140

MMKTLLLFVGLLLTWESGQVLGDQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLI
EKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQT
CMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHF
SRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNF
HAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKD
QCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLE
QLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVP
VEVSRKNPKFMETVAEKALQEYRKKHREE

when I down the fast file for exon I get this, are different and code same aa?

Probably has an easy answer but not me either my friend understand it. If someone can explain to us we will appreciate.

Thanks!!!

>CLU-001 ENSE00001236158 exon:KNOWN_protein_coding
TGTGTCTTGGACTGGGACAGACAGCCGGGCTAACCGCGTGAGAGGGGCTCCCAGATGGGC
ACGCGAGTTCAGGCTCTTCCCTACTGGAAGCGCCGAGCGGCCGCACCTCAGGGTCTCTCC
TGGAGCCAGCACAGCTATTCGTGGTGATGATGCGCCCCCCGGCGCCCCCAGCCCGGTGCT
GCACCGGCCCCCACCTCCCGGCTTCCAGAAAGCTCCCCTTGCTTTCCGCGGCATTCTTTG
GGCGTGAGTCATGCAGGTTTGCAGCCAGCCCCAAAGGGGGTGTGTGCGCGAGCAGAGCGC
TATAAATACGGCGCCTCCCAGTGCCCACAACGCGGCGTCGCCAGGAGGAGCGCGCGGGCA
CAGGGTGCCGCTGACCG
>CLU-001 ENSE00003673710 exon:KNOWN_protein_coding
AGGCGTGCAAAGACTCCAGAATTGGAGGCATGATGAAGACTCTGCTGCTGTTTGTGGGGC
TGCTGCTGACCTGGGAGAGTGGGCAGGTCCTGGGGGACCAGACGGTCTCAGACAATGAGC
TCCAGG
>CLU-001 ENSE00003638747 exon:KNOWN_protein_coding
AAATGTCCAATCAGGGAAGTAAGTACGTCAATAAGGAAATTCAAAATGCTGTCAACGGGG
TGAAACAGATAAAGACTCTCATAGAAAAAACAAACGAAGAGCGCAAGACACTGCTCAGCA
ACCTAGAAGAAGCCAAGAAGAAGAAAGAG
>CLU-001 ENSE00003786357 exon:KNOWN_protein_coding
GATGCCCTAAATGAGACCAGGGAATCAGAGACAAAGCTGAAGGAGCTCCCAGGAGTGTGC
AATGAGACCATGATGGCCCTCTGGGAAGAGTGTAAGCCCTGCCTGAAACAGACCTGCATG
AAGTTCTACGCACGCGTCTGCAGAAGTGGCTCAGGCCTGGTTGGCCGCCAG
>CLU-001 ENSE00003678973 exon:KNOWN_protein_coding
CTTGAGGAGTTCCTGAACCAGAGCTCGCCCTTCTACTTCTGGATGAATGGTGACCGCATC
GACTCCCTGCTGGAGAACGACCGGCAGCAGACGCACATGCTGGATGTCATGCAGGACCAC
TTCAGCCGCGCGTCCAGCATCATAGACGAGCTCTTCCAGGACAGGTTCTTCACCCGGGAG
CCCCAGGATACCTACCACTACCTGCCCTTCAGCCTGCCCCACCGGAGGCCTCACTTCTTC
TTTCCCAAGTCCCGCATCGTCCGCAGCTTGATGCCCTTCTCTCCGTACGAGCCCCTGAAC
TTCCACGCCATGTTCCAGCCCTTCCTTGAGATGATACACGAGGCTCAGCAGGCCATGGAC
ATCCACTTCCATAGCCCGGCCTTCCAGCACCCGCCAACAGAATTCATACGAG
>CLU-001 ENSE00003639154 exon:KNOWN_protein_coding
AAGGCGACGATGACCGGACTGTGTGCCGGGAGATCCGCCACAACTCCACGGGCTGCCTGC
GGATGAAGGACCAGTGTGACAAGTGCCGGGAGATCTTGTCTGTGG
>CLU-001 ENSE00001236166 exon:KNOWN_protein_coding
ACTGTTCCACCAACAACCCCTCCCAGGCTAAGCTGCGGCGGGAGCTCGACGAATCCCTCC
AGGTCGCTGAGAGGTTGACCAGGAAATACAACGAGCTGCTAAAGTCCTACCAGTGGAAGA
TGCTCAACACCTCCTCCTTGCTGGAGCAGCTGAACGAGCAGTTTAACTGGGTGTCCCGGC
TGGCAAACCTCACGCAAGGCGAAGACCAGTACTATCTGCGGGTCACCACG
>CLU-001 ENSE00000818629 exon:KNOWN_protein_coding
GTGGCTTCCCACACTTCTGACTCGGACGTTCCTTCCGGTGTCACTGAGGTGGTCGTGAAG
CTCTTTGACTCTGATCCCATCACTGTGACGGTCCCTGTAGAAGTCTCCAGGAAGAACCCT
AAATTTATGGAGACCGTGGCGGAGAAAGCGCTGCAGGAATACCGCAAAAAGCACCG
>CLU-001 ENSE00001817846 exon:KNOWN_protein_coding
GGAGGAGTGAGATGTGGATGTTGCTTTTGCACCTACGGGGGCATCTGAGTCCAGCTCCCC
CCAAGATGAGCTGCAGCCCCCCAGAGAGAGCTCTGCACGTCACCAAGTAACCAGGCCCCA
GCCTCCAGGCCCCCAACTCCGCCCAGCCTCTCCCCGCTCTGGATCCTGCACTCTAACACT
CGACTCTGCTGCTCATGGGAAGAACAGAATTGCTCCTGCATGCAACTAATTCAATAAAAC
TGTCTTGTGAGCTGATCGCTTGGAGGGTCCTCTTTTTATGTTGAGTTGCTGCTTCCCGGC
ATGCCTTCATTTTGCTATGGGGGGCAGGCAGGGGGGATGGAAAATAAGTAGAAACAAAAA
AGCAGTGGCTAAGATGGTATAGGGACTGTCATACCAGTGAAGAATAAAAGGGTGAAGAAT
AAAAGGGATATGATGACAAGGTTGATCCACTTCAAGAATTGCTTGCTTTCAGGAAGAGAG
ATGTGTTTCAACAAGCCAACTAAAATATATTGCTGCAAATGGAAGCTTTTCTGTTCTATT
ATAAAACTGTCGATGTATTCTGACCAAGGTGCGACAATCTCCTAAAGGAATACACTGAAA
GTTAAGGAGAAGAATCAGTAAGTGTAAGGTGTACTTGGTATTATAATGCATAATTGATGT
TTTCGTTATGAAAACATTTGGTGCCCAGAAGTCCAAATTATCAGTTTTATTTGTAAGAGC
TATTGCTTTTGCAGCGGTTTTATTTGTAAAAGCTGTTGATTTCGAGTTGTAAGAGCTCAG
CATCCCAGGGGCATCTTCTTGACTGTGGCATTTCCTGTCCACCGCCGGTTTATATGATCT
TCATACCTTTCCCTGGACCACAGGCGTTTCTCGGCTTTTAGTCTGAACCATAGCTGGGCT
GCAGTACCCTACGCTGCCAGCAGGTGGCCATGACTACCCGTGGTACCAATCTCAGTCTTA
AAGCTCAGGCTTTTCGTTCATTAACATTCTCTGATAGAATTCTGGTCATCAGATGTACTG
CAATGGAACAAAACTCATCTGGCTGCATCCCAGGTGTGTAGCAAAGTCCACATGTAAATT
TATAGCTTAGAATATTCTTAAGTCACTGTCCCTTGTCTCTCTTTGAAGTTATAAACAACA
AACTTAAAGCTTAGCTTATGTCCAAGGTAAGTATTTTAGCATGGCTGTCAAGGAAATTCA
GAGTAAAGTCAGTGTGATTCACTTAATGATATACATTAATTAGAATTATGGGGTCAGAGG
TATTTGCTTAAGTGATCATAATTGTAAAGTATATGTCACATTGTCACATTAATGTCACAC
TGTTTCAAAAGTTA

>CLU-004 ENSE00001553936 exon:KNOWN_protein_coding
AACACTGGCAGGGCAGCCTGCTGTCGGCTTAGAGGGGATGGGCAGTGTGGAGGGCCTGGC
AGAGCAAGAGGACTCATCCTTCCAAAGGGACTTTCTCTGGGAAGCCTGCTCCTCGGGCCA
CTGCGAACCCTCTCTACTCTCCGAAGGGAATTGTCCTTCCTGGCTTCCACTACTTCCACC
CCTGAATGCACAGGCAGCCCGGCCCAAGTCTCCCACTAGGGATGCAGATGGATTCGGTGT
GAAGGGCTGGCTGCTGTTGCCTCCGGCTCTTGAAAGTCAAGTTCAG
>CLU-004 ENSE00003673710 exon:KNOWN_protein_coding
AGGCGTGCAAAGACTCCAGAATTGGAGGCATGATGAAGACTCTGCTGCTGTTTGTGGGGC
TGCTGCTGACCTGGGAGAGTGGGCAGGTCCTGGGGGACCAGACGGTCTCAGACAATGAGC
TCCAGG
>CLU-004 ENSE00003638747 exon:KNOWN_protein_coding
AAATGTCCAATCAGGGAAGTAAGTACGTCAATAAGGAAATTCAAAATGCTGTCAACGGGG
TGAAACAGATAAAGACTCTCATAGAAAAAACAAACGAAGAGCGCAAGACACTGCTCAGCA
ACCTAGAAGAAGCCAAGAAGAAGAAAGAG
>CLU-004 ENSE00003786357 exon:KNOWN_protein_coding
GATGCCCTAAATGAGACCAGGGAATCAGAGACAAAGCTGAAGGAGCTCCCAGGAGTGTGC
AATGAGACCATGATGGCCCTCTGGGAAGAGTGTAAGCCCTGCCTGAAACAGACCTGCATG
AAGTTCTACGCACGCGTCTGCAGAAGTGGCTCAGGCCTGGTTGGCCGCCAG
>CLU-004 ENSE00003678973 exon:KNOWN_protein_coding
CTTGAGGAGTTCCTGAACCAGAGCTCGCCCTTCTACTTCTGGATGAATGGTGACCGCATC
GACTCCCTGCTGGAGAACGACCGGCAGCAGACGCACATGCTGGATGTCATGCAGGACCAC
TTCAGCCGCGCGTCCAGCATCATAGACGAGCTCTTCCAGGACAGGTTCTTCACCCGGGAG
CCCCAGGATACCTACCACTACCTGCCCTTCAGCCTGCCCCACCGGAGGCCTCACTTCTTC
TTTCCCAAGTCCCGCATCGTCCGCAGCTTGATGCCCTTCTCTCCGTACGAGCCCCTGAAC
TTCCACGCCATGTTCCAGCCCTTCCTTGAGATGATACACGAGGCTCAGCAGGCCATGGAC
ATCCACTTCCATAGCCCGGCCTTCCAGCACCCGCCAACAGAATTCATACGAG
>CLU-004 ENSE00003639154 exon:KNOWN_protein_coding
AAGGCGACGATGACCGGACTGTGTGCCGGGAGATCCGCCACAACTCCACGGGCTGCCTGC
GGATGAAGGACCAGTGTGACAAGTGCCGGGAGATCTTGTCTGTGG
>CLU-004 ENSE00001236166 exon:KNOWN_protein_coding
ACTGTTCCACCAACAACCCCTCCCAGGCTAAGCTGCGGCGGGAGCTCGACGAATCCCTCC
AGGTCGCTGAGAGGTTGACCAGGAAATACAACGAGCTGCTAAAGTCCTACCAGTGGAAGA
TGCTCAACACCTCCTCCTTGCTGGAGCAGCTGAACGAGCAGTTTAACTGGGTGTCCCGGC
TGGCAAACCTCACGCAAGGCGAAGACCAGTACTATCTGCGGGTCACCACG
>CLU-004 ENSE00000818629 exon:KNOWN_protein_coding
GTGGCTTCCCACACTTCTGACTCGGACGTTCCTTCCGGTGTCACTGAGGTGGTCGTGAAG
CTCTTTGACTCTGATCCCATCACTGTGACGGTCCCTGTAGAAGTCTCCAGGAAGAACCCT
AAATTTATGGAGACCGTGGCGGAGAAAGCGCTGCAGGAATACCGCAAAAAGCACCG
>CLU-004 ENSE00001783877 exon:KNOWN_protein_coding
GGAGGAGTGAGATGTGGATGTTGCTTTTGCACCTACGGGGGCATCTGAGTCCAGCTCCCC
CCAAGATGAGCTGCAGCCCCCCAGAGAGAGCTCTGCACGTCACCAAGTAACCAGGCCCCA
GCCTCCAGGCCCCCAACTCCGCCCAGCCTCTCCCCGCTCTGGATCCTGCACTCTAACACT
CGACTCTGCTGCTCATGGGAAGAACAGAATTGCTCCTGCATGCAACTAATTCAATAAAAC
TGTCTTGTGAGCTGATCGCTTGGAGGGTCCTCTTTTTATGTTGAGTTGCTGCTTCCCGGC
ATGCCTTCATTTTGCTATGGGGGGCAGGCAGGGGGGATGGAAAATAAGTAGAAACAAAAA
AGCAGTGGCTAAGATGGTATAGGGACTGTCATACCAGTGAAGAATAAAAGGGTGAAGAAT
AAAAGGGATATGATGACAAGGTT

>CLU-003 ENSE00002108331 exon:KNOWN_protein_coding
CATCCTTCCAAAGGGACTTTCTCTGGGAAGCCTGCTCCTCGGGCCACTGCGAACCCTCTC
TACTCTCCGAAGGGAATTGTCCTTCCTGGCTTCCACTACTTCCACCCCTGAATGCACAGG
CAGCCCGGCCCAAGTCTCCCACTAGGGATGCAGATGGATTCGGTGTGAAGGGCTGGCTGC
TGTTGCCTCCGGCTCTTGAAAGTCAAGTTCAGGTGGTGCTGAGACTCCCTGGGGGCTGCA
GCGCTGTGGTGAATGGGGAGCGTCTGCTGGGGTGAAGGTTTAGGTGCACATTGCAGAGGA
CGTGGCTGGTCTCTGGGATGCAGTCCCTCTGTGGAGGTGGCATGGGGAGGGACGGATGCA
TGACCTAAGGGGGGTATTTTCAGTGTCTGACATGATCGATACCACTCTGGACAAGGAGGC
CAGGATGCAGAAAGCCTGTGTGCCTCGCTGATTGTCGGGGAGGATGTGGCTTGGACAAGA
GCCTGGTTCCTCCGATGCCAGGGTTCTTGTTTCTTCCACTCAACATTGCTGTCCTGCAGT
CCCTCCCTCCCTGCACCTCCTGCCTTCGCTTTCATTCGAGGTGTCCATGGCAAGTCTGGT
CATTTCCCCCCATTTCCTCAGGAATAAAAGTGCAGCAGTGCCTGCTGTGGGGACAGCTGA
GGGCAGTGAGGCCCTGGGGAGCTGCTGCAGGCAGCAGGTGGGCGGGACGCCAGCAGGCTG
TCTAGCTGTTCCCATGATGGTCTCCTGTTCTCTGCAGAGGCGTGCAAAGACTCCAGAATT
GGAGGCATGATGAAGACTCTGCTGCTGTTTGTGGGGCTGCTGCTGACCTGGGAGAGTGGG
CAGGTCCTGGGGGACCAGACGGTCTCAGACAATGAGCTCCAGG
>CLU-003 ENSE00003638747 exon:KNOWN_protein_coding
AAATGTCCAATCAGGGAAGTAAGTACGTCAATAAGGAAATTCAAAATGCTGTCAACGGGG
TGAAACAGATAAAGACTCTCATAGAAAAAACAAACGAAGAGCGCAAGACACTGCTCAGCA
ACCTAGAAGAAGCCAAGAAGAAGAAAGAG
>CLU-003 ENSE00003786357 exon:KNOWN_protein_coding
GATGCCCTAAATGAGACCAGGGAATCAGAGACAAAGCTGAAGGAGCTCCCAGGAGTGTGC
AATGAGACCATGATGGCCCTCTGGGAAGAGTGTAAGCCCTGCCTGAAACAGACCTGCATG
AAGTTCTACGCACGCGTCTGCAGAAGTGGCTCAGGCCTGGTTGGCCGCCAG
>CLU-003 ENSE00003678973 exon:KNOWN_protein_coding
CTTGAGGAGTTCCTGAACCAGAGCTCGCCCTTCTACTTCTGGATGAATGGTGACCGCATC
GACTCCCTGCTGGAGAACGACCGGCAGCAGACGCACATGCTGGATGTCATGCAGGACCAC
TTCAGCCGCGCGTCCAGCATCATAGACGAGCTCTTCCAGGACAGGTTCTTCACCCGGGAG
CCCCAGGATACCTACCACTACCTGCCCTTCAGCCTGCCCCACCGGAGGCCTCACTTCTTC
TTTCCCAAGTCCCGCATCGTCCGCAGCTTGATGCCCTTCTCTCCGTACGAGCCCCTGAAC
TTCCACGCCATGTTCCAGCCCTTCCTTGAGATGATACACGAGGCTCAGCAGGCCATGGAC
ATCCACTTCCATAGCCCGGCCTTCCAGCACCCGCCAACAGAATTCATACGAG
>CLU-003 ENSE00003639154 exon:KNOWN_protein_coding
AAGGCGACGATGACCGGACTGTGTGCCGGGAGATCCGCCACAACTCCACGGGCTGCCTGC
GGATGAAGGACCAGTGTGACAAGTGCCGGGAGATCTTGTCTGTGG
>CLU-003 ENSE00001236166 exon:KNOWN_protein_coding
ACTGTTCCACCAACAACCCCTCCCAGGCTAAGCTGCGGCGGGAGCTCGACGAATCCCTCC
AGGTCGCTGAGAGGTTGACCAGGAAATACAACGAGCTGCTAAAGTCCTACCAGTGGAAGA
TGCTCAACACCTCCTCCTTGCTGGAGCAGCTGAACGAGCAGTTTAACTGGGTGTCCCGGC
TGGCAAACCTCACGCAAGGCGAAGACCAGTACTATCTGCGGGTCACCACG
>CLU-003 ENSE00000818629 exon:KNOWN_protein_coding
GTGGCTTCCCACACTTCTGACTCGGACGTTCCTTCCGGTGTCACTGAGGTGGTCGTGAAG
CTCTTTGACTCTGATCCCATCACTGTGACGGTCCCTGTAGAAGTCTCCAGGAAGAACCCT
AAATTTATGGAGACCGTGGCGGAGAAAGCGCTGCAGGAATACCGCAAAAAGCACCG
>CLU-003 ENSE00003468265 exon:KNOWN_protein_coding
GGAGGAGTGAGATGTGGATGTTGCTTTTGCACCTACGGGGGCATCTGAGTCCAGCTCCCC
CCAAGATGAGCTGCAGCCCCCCAGAGAGAGCTCTGCACGTCACCAAGTAACCAGGCCCCA
GCCTCCAGGCCCCCAACTCCGCCCAGCCTCTCCCCGCTCTGGATCCTGCACTCTAACACT
CGACTCTGCTGCTCATGGGAAGAACAGAATTGCTCCTGCATGCAACTAATTCAATAAAAC
TGTCTTGTGAGCTGA
sequencing • 493 views
ADD COMMENTlink modified 2.5 years ago by genomax70k • written 2.5 years ago by cristina_sabiers60

As far as I could see the encoded protein is 449 AA in all three cases. Did you compare the UTRs of the three mRNA sequences?

ADD REPLYlink written 2.5 years ago by russhh4.6k

no...thank you so much, I will tell her.

ADD REPLYlink written 2.5 years ago by cristina_sabiers60
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1692 users visited in the last hour