Question: GI identifiers lost
0
gravatar for albert.rafels
8 months ago by
albert.rafels0 wrote:

I have a set of proteins from diverse Bacteria. I'm trying to analyze them using DAVID but it cannot recognize more than 80% of my GI numbers. Here you have one example:

gi|386865221|ref|YP_006278169.1| membrane-anchored cell surface protein [Burkholderia pseudomallei 1026b]

So, the GI numbers is:

386865221

But DAVID (with identifier as PROTEIN_GI_ACCESSION) cannot recognize it. I also tried with NCBI to find the GI number but, there is nothing. Finally, I did a protein blast with the original protein sequence (see below) and I obtained a 100% match protein:

AFI69771.1 membrane-anchored cell surface protein [Burkholderia pseudomallei 1026b]

Strikingly, I tried to make an ID conversion with biodbnet but, again, I didn't found anything.

GI identifier without any AFI associated

My question is, is there any easy way to relate my GI and AFI identifiers?

gi|386865221|ref|YP_006278169.1| membrane-anchored cell surface protein [Burkholderia pseudomallei 1026b] MNKIYKTIWCETTRSWVAVSEHANGKRGGATAAATTSARPIWTRLRGISLAALAAFGLGLFASPAAFAQS NSVMCANYNNGILPTYTGYGASPSLTSPCTTGIGSWAGGVTPGSTTNWIGLSADDTQIVLNGSTGNIYFR AGGTNGNTLTMSNVAGSGPTGGVLLSGVAAGAVTATSSQAINGSQLYSLSTSASTGIGSLSSSMSTFNSS ISSLSTGLSSTNSGLTSLSTSASTGLSSANSSIASLSSGLSSTNSSLTSLSTSASSGISTAQSGVNSLST GLSTTNSTVASLSTSTSTGIGSLSTGLSSTNSSLTSLSTSASSGISSANSSVASLSTSTSTGIGSLSTGL ISTNSSLTSLSTSASSGISTAQSGVNSLSTGLSTTNSTVASLSTSTSTGIGSLSTGLSSTNSSLTSLSTS ASSGISSANSSVASLSTSTSTGIGSLSTGLSSTNSSLTSLSTSASSGISSANSSVASLSTSTSTGIGSLS TGLSSTNSSLTSLSTSASSGISTAQSGVNSLSTGLSTTNSTVASLSTSTSTGIGSLSTGLSSTNSSLTSL STSTSSGISSANSSIASLSTSTSTGISSLSTGLSTTDSNLASLSTSTSTGLSSATSSIASLSTSTSTGIG SLSTGLSTTNSNLTSLSTSTSTGLSSANSSITSLSSGLSTTNSNVASLSSGLSSTNSSLTSLSTSTSSGI SSANSSVASLSTSTSTGIGSLSTGLSTTNSNLTSLSTSTSTGLSSANSSITSLSSGLSTTNSNVASLSTG LSSTNSSLTSLSTSTSSGISSANSSIASLSTSTSTGISSLSTGLSTTDSNLTSLSTSTSTGLSSANSSIT SLSSGLSTTNSNVASLSSGLSATNSSLTSLSTSASSGISSANSSVASLSTSTSTGIGSLSTGLSTTNSNL TSLSTSTSTSLSSANSSITSLSSGLSTTNSNVASLSTGLSSTNSSLTSLSTSASSGISSANSSVASLSTS TSTGLSSANSSITSLSSGLSTTNSNVASLSSGLSTTNSSLTSLSTSASSGISSANSSIASLSTSTSTGIS SLSTGLSTTDSNLASLSTSTSTGLSSAASSIASLSTSTSTGISSLSTGLSTTDSNLTSLSTSTSTGLSSA NSSITSLSSGLSTTNSNVASLSSGLSTTNSSVASLSTGLSTTDSNLASLSTSTSTGLSSTTSSIASLSTS TSTSVDSLSTGLSTTNSSVASLSTGLSTTDSSLASLSTSTSTGLSSTTSSIASLSTSTSTSFSSALSSIG SLSTGLATTNSNLASLSTSTLTSVSSLSTGLSATNSSVASLSTSASTGLAATNSTVASLSTSTSTAVGSL STGLSTTNSNVASLSTSTSTAVGSLSTSLSTTNSNVASLSTSTSTSVNSLSTGLSTTNTSVASLSTSVTN LNTQLTSLSTTIVNSTNNVIRALPASTGIAADMSAPNAAAPSVTAGSNSVALGANSTDGGRSNVVSVGSA TQQRQITNVAAGTEGTDAVNVNQLNALSTSMSQSLAGQQGQINNLGSQLTQTQQALQQTDTMARQGIAAA TALTMLPQVEPGKTINVAVGVARFAGQSGMAFGASAHVTTNGILKLGIGVSGQNKTFGAGYGYSW

ADD COMMENTlink modified 8 months ago • written 8 months ago by albert.rafels0
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 848 users visited in the last hour