Question: modify header of sequencs in fasta file
0
gravatar for Jason
9 months ago by
Jason0
Jason0 wrote:

Hello everybody, I am not and expert with sed and I am sure that someone will do this work faster and better than me.

I would like to edit multiple fasta header from this format.

>NV_000007.1 very long-chain specific acyl-CoA dehydrogenase, mitochondrial isoform 1 precursor [Homo sapiens]
MQAARMAASLGRQLLRLGGGSSRLTALLGQPRPGPARRPYAGGAAQLALDKSDSHPSDALTRKKPAKAES

Result should be like below:

>sp|NV_000007.1|very long-chain specific acyl-CoA dehydrogenase, mitochondrial isoform 1 precursor [Homo sapiens]
MQAARMAASLGRQLLRLGGGSSRLTALLGQPRPGPARRPYAGGAAQLALDKSDSHPSDALTRKKPAKAES
sequencing • 305 views
ADD COMMENTlink modified 9 months ago by Pierre Lindenbaum111k • written 9 months ago by Jason0
1
gravatar for Pierre Lindenbaum
9 months ago by
France/Nantes/Institut du Thorax - INSERM UMR1087
Pierre Lindenbaum111k wrote:
sed 's/^>/>sp|/;/^>/s/ /|/'
ADD COMMENTlink written 9 months ago by Pierre Lindenbaum111k
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 633 users visited in the last hour