Question: modify header of sequencs in fasta file
0
gravatar for Jason
8 days ago by
Jason0
Jason0 wrote:

Hello everybody, I am not and expert with sed and I am sure that someone will do this work faster and better than me.

I would like to edit multiple fasta header from this format.

>NV_000007.1 very long-chain specific acyl-CoA dehydrogenase, mitochondrial isoform 1 precursor [Homo sapiens]
MQAARMAASLGRQLLRLGGGSSRLTALLGQPRPGPARRPYAGGAAQLALDKSDSHPSDALTRKKPAKAES

Result should be like below:

>sp|NV_000007.1|very long-chain specific acyl-CoA dehydrogenase, mitochondrial isoform 1 precursor [Homo sapiens]
MQAARMAASLGRQLLRLGGGSSRLTALLGQPRPGPARRPYAGGAAQLALDKSDSHPSDALTRKKPAKAES
sequencing • 111 views
ADD COMMENTlink modified 8 days ago by Pierre Lindenbaum101k • written 8 days ago by Jason0
1
gravatar for Pierre Lindenbaum
8 days ago by
France/Nantes/Institut du Thorax - INSERM UMR1087
Pierre Lindenbaum101k wrote:
sed 's/^>/>sp|/;/^>/s/ /|/'
ADD COMMENTlink written 8 days ago by Pierre Lindenbaum101k
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1351 users visited in the last hour