Question: error in orthoBlastParser
0
gravatar for vjain
14 months ago by
vjain0
vjain0 wrote:

I am facing an error when I run orthomclBlastParser:

bin/orthomclBlastParser ortholog/out.tab my_orthomcl_dir/compliantFasta/Blast/ >> similarSequences.txt acquiring genes from arab.fasta couldn't find taxon for gene 'TRINITY_DN10001_c0_g1_i2.p1' at /home/mobashirm/Documents/orthomclSoftware-v2.0.9/bin/orthomclBlastParser line 106, <f> line 1.

I run Blast between the following two files:

1) The database arab.fast file looks like:

arab|NP_001030613.1 MLLSALLTSVGINLGLCFLFFTLYSILRKQPSNVTVYGPRLVKKDGKSQQSNEFNLERLLPTAGWVKRALEPTNDEILSN arab|NP_001030614.1 MEMEEGASGVGEKIKIGVCVMEKKVFSAPMGEILDRLQSFGEFEILHFGDKVILEDPIESWPICDCLIAFHSSGYPLEKA

2) My raw file against which blast is performed:

TRINITY_DN10001_c0_g1_i1.p1 TRINITY_DN10001_c0_g1~~TRINITY_DN10001_c0_g1_i1.p1 ORF type:3prime_partial len:377 (-),score=66.02 TRINITY_DN10001_c0_g1_i1:1-1128(-) MGIRSCQLIACLSALSIADAKRPTVDVAMSQAALEPPETIGGSASTQFRRSLLQAGAKSG TRINITY_DN10001_c0_g1_i2.p1 TRINITY_DN10001_c0_g1~~TRINITY_DN10001_c0_g1_i2.p1 ORF type:complete len:154 (-),score=0.19 TRINITY_DN10001_c0_g1_i2:112-573(-) MGIRSCQLIACLSALSIADAKRPTVDVAMSQAALEPPETIGGSASTQFRRSLLQAGAKSG TSGCKWAGAAAGCIADGSFFQSKGGFEPMDEFLACLNATTSGADLSCSPGETCCTPYLHY SSLHKQYIHSTIVKKCTFPRHIMSAVVLVYSTW*

The output file after Blast is:

TRINITY_DN10001_c0_g1_i2.p1 arab|NP_180470.2 27.08 96 63 2 22 110 29 124 3e-06 29.6 TRINITY_DN10001_c0_g1_i2.p1 arab|NP_191320.1 31.58 57 31 1 20 76 38 86 7e-06 28.9 TRINITY_DN10002_c0_g2_i1.p1 arab|NP_198034.2 31.43 70 45 1 47 116 328 394 3e-08 35.8

Please help me sort this.

ADD COMMENTlink modified 14 months ago by Philipp Bayer6.1k • written 14 months ago by vjain0
0
gravatar for Philipp Bayer
14 months ago by
Philipp Bayer6.1k
Australia/Perth/UWA
Philipp Bayer6.1k wrote:

Have you run orthomclAdjustFasta on your TRINITY assembly? It doesn't look like it, it needs the '|' character everywhere, so it should be

>abc|TRINITY_DN100001_c0_g1_i2.p1
>abc|TRINITY_DN100002_c0_g2_i1.p1

etc., where abc is your species shorthand of choice.

ADD COMMENTlink written 14 months ago by Philipp Bayer6.1k

Yes Philipp Bayer, I generated a new file with adjusted the trinity file accordingly but I am still facing the same error.

ADD REPLYlink written 14 months ago by vjain0

But looking at the BLAST example output file above the 'abc|TRINITY' .. is not there, it's just 'TRINITY..'? You can rename them in the BLAST file using sed, or by rerunning BLAST

ADD REPLYlink written 14 months ago by Philipp Bayer6.1k
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1304 users visited in the last hour