extracting the longest transcript in a fasta file
0
0
Entering edit mode
3.4 years ago
alireza346 ▴ 10

I have a fasta file like this example:

>ENST00000511961.1|ENSG00000013561.13|OTTHUMG00000129660.5|OTTHUMT00000370661.3|RNF14-003|RNF14|278  
MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQ
>ENST00000506822.1|ENSG00000013561.13|OTTHUMG00000129660.5|OTTHUMT00000370662.1|RNF14-004|RNF14|132
MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKE
>ENST00000513019.1|ENSG00000013561.13|OTTHUMG00000129660.5|OTTHUMT00000370663.1|HAS-0|HAS|99 
MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLS
>ENST00000356143.1|ENSG00000013561.13|OTTHUMG00000129660.5|-|HAS-202|HAS|474
MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKAL

I m trying to take the longest transcript of each gene. here is the expected output:

>ENST00000511961.1|ENSG00000013561.13|OTTHUMG00000129660.5|OTTHUMT00000370661.3|RNF14-003|RNF14|278
MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQ
>ENST00000356143.1|ENSG00000013561.13|OTTHUMG00000129660.5|-|HAS-202|HAS|474
MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFLPPLVLNFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKAL

do you know how I can do that? in fact in the ID line, I have the gene names in the 6th line and the length in the 7th line. and I want to get one repeat of each gene name based on the 7th column.

gene • 3.1k views
ADD COMMENT
0
Entering edit mode
ADD REPLY
0
Entering edit mode

Have a look here it has been already discussed

ADD REPLY
0
Entering edit mode

actually these are not working for my question

ADD REPLY
0
Entering edit mode
ADD REPLY
0
Entering edit mode

it dies not return any output

ADD REPLY
0
Entering edit mode

You have been given two links, with two solutions each. You mean all four solutions died, without returning any output?

ADD REPLY
0
Entering edit mode

You can sort the FASTA by sequence length using SEDA (http://www.sing-group.org/seda/manual/operations.html#sort) and then take the longest sequence(s).

ADD REPLY

Login before adding your answer.

Traffic: 1836 users visited in the last hour
Help About
FAQ
Access RSS
API
Stats

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.

Powered by the version 2.3.6