Question: Codeml BEB positive sites don't match amino acids in alignment
0
gravatar for maggie.bartlett
11 days ago by
maggie.bartlett0 wrote:

I'm trying to look at potential positive selection sites in genes of interest using EasyCodeml. I can run the GUI, but the results don't always match my protein sequences. Does anyone know what causes this?

GUI OUTPUT: Branch site model (BSM)
Model np Ln L Estimates of parameters Model compared LRT P-value Positive sites Model A 16 -2510.225991 Site class 0 1 2a 2b Model A vs.Model A null 0.046986273 3 L 0.672,12 N 0.524,21 S 0.558,39 A 0.507,97 S 0.519,102 C 0.551,110 G 0.560,116 T 0.522,125 R 0.516,154 R 0.537,157 C 0.852,162 S 0.578,168 L 0.575,171 N 0.574,179 R 0.501,185 R 0.562 f 0.38068 0.52904 0.03778 0.05250
ω0 1.00000 1.00000 1.00000 1.00000
ω1 1.00000 1.00000 17.13576 17.13576
Model A null 15 -2512.198931 1 Not Allowed

AA SEQUENCE: MLQTVGPCGLRLLPPLPVLLLLASADREAGLPKATLSLDPPWVNVLQGDNVTLTCRGAPGPGSPATRWFHNGNFLETQAQSSYSLTANSSDSGNYTCHTAQTSLSDPVHLDVVSDWLLLQTPRLLFQEGEPIVLRCHSWKGWPLYKVTFFHNKTSRKFSHTDFIFSIPRANSSHSGKYHCTGFIRKSRYSSQAVSIAVRGPAVPSISPLFALWPQITFCLVMGLLFAVDTGLYFSMKRDLRRLMGDWTNGKVTWSKSPEDK

ADD COMMENTlink modified 11 days ago • written 11 days ago by maggie.bartlett0
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 2080 users visited in the last hour