Question: (Closed) Makeblastdb Error
2
gravatar for Euphorbium
7.5 years ago by
Euphorbium40
Euphorbium40 wrote:

I get this error when trying to make a database from fasta file:

BLAST options error: blastdb.FASTA does not match input format type, default input type is FASTA

here is sample of my file:

 >1_551115_38.3736667550712
MPFFTAYVSFYAPLDFFSPQFLPVALYGAECGLYATFITDIKLSDSKNNSLGEQGDFVSWGKDCAFSYSNYRYR
 >2_551115_38.3736667550712
MRQKILAKDLSQTELVQSIDRKGIAEESMGQKVEILLSLIEQ

what is wrong with it?

blast • 2.8k views
ADD COMMENTlink modified 7.5 years ago • written 7.5 years ago by Euphorbium40
2
gravatar for Euphorbium
7.5 years ago by
Euphorbium40
Euphorbium40 wrote:

Ok, I've found out where the problem was. There was a space before > symbol.

ADD COMMENTlink written 7.5 years ago by Euphorbium40

thanks for following up

ADD REPLYlink written 7.5 years ago by Istvan Albert ♦♦ 81k
Please log in to add an answer.
The thread is closed. No new answers may be added.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 679 users visited in the last hour