How to select loops in protein structure?
1
0
Entering edit mode
8 months ago
studia.biot ▴ 20

Is it possible to automatically select loops in the protein or do i have to do it manually by typing residues numbers?

protein pdb python • 287 views
ADD COMMENT
0
Entering edit mode

what do you consider as 'loops' ? and did you already identified them or is that part of the question as well?

ADD REPLY
0
Entering edit mode

Loops are small fragments that link secondary structures in protein. I need to select loops from the protein structure - I don't know which residue is a loop.

ADD REPLY
0
Entering edit mode

In what tool? You can do this in UCSF chimera (at least in principle).

ADD REPLY
0
Entering edit mode
8 months ago
Mensur Dlakic ★ 14k

There are many programs that assign secondary structure from PDB files. For example, this is what STRIDE assigns to PDB structure 1ako:

REM  -------------------- Secondary structure summary -------------------  1AKO
REM                                                                        1AKO
CHN  1ako.pdb A                                                            1AKO
REM                                                                        1AKO
REM                .         .         .         .         .               1AKO
SEQ  1    MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKL   50          1AKO
STR        EEEEEETTTGGG HHHHHHHHHHH TTEEEEETT   GGGTTHHHHHHH               1AKO
REM                                                                        1AKO
REM                .         .         .         .         .               1AKO
SEQ  51   GYNVFYHGQKGHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSLL  100          1AKO
STR         EEEEEEETTEEEEEEEETTTTTEEEE TTTT HHHHH EEEEEEEETT               1AKO
REM                                                                        1AKO
REM                .         .         .         .         .               1AKO
SEQ  101  GNVTVINGYFPQGESRDHPIKFPAKAQFYQNLQNYLETELKRDNPVLIMG  150          1AKO
STR       EEEEEEEEE   TTBTTT HHHHHHHHHHHHHHHHHHHH TTTT EEEEE               1AKO
REM                                                                        1AKO
REM                .         .         .         .         .               1AKO
SEQ  151  DMNISPTDLDIGIGEENRKRWLRTGKCSFLPEEREWMDRLMSWGLVDTFR  200          1AKO
STR       E      GGGB   HHHHHHHHHH BTTTTHHHHHHHHHHHHH EEEHHH               1AKO
REM                                                                        1AKO
REM                .         .         .         .         .               1AKO
SEQ  201  HANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAECCVETGIDYEI  250          1AKO
STR       HHTTTTTTT  EETTTTTGGGG  EE  EEEEEEHHHHH EEEEEE HHH               1AKO
REM                                                                        1AKO
REM                .                                                       1AKO
SEQ  251  RSMEKPSDHAPVWATFRR                                  268          1AKO
STR       HHTTTT  B  EEEEE                                                 1AKO
REM                                                                        1AKO
REM                                                                        1AKO
REM                                                                        1AKO

Any letter (or empty space) under the sequence that is not E, G or H is a loop. But I am guessing that is not what you want. If you are using a particular program and need to identify loops without typing the residues manually, first you need to tell us what that program is.

ADD COMMENT
0
Entering edit mode

The program is pyRosetta.

ADD REPLY
0
Entering edit mode

Don't know how to do it in that program, but there is an extensive manual for it that likely covers residue selection based on their secondary structure.

ADD REPLY

Login before adding your answer.

Traffic: 2229 users visited in the last hour
Help About
FAQ
Access RSS
API
Stats

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.

Powered by the version 2.3.6