query sequence is input sequence or its reverse complement
0
0
Entering edit mode
7 weeks ago
>sp|O14920.1|IKKB_HUMAN RecName: Full=Inhibitor of nuclear factor kappa-B kinase subunit beta; Short=I-kappa-B-kinase beta; Short=IKK-B; Short=IKK-beta; Short=IkBKB; AltName: Full=I-kappa-B kinase 2; Short=IKK2; AltName: Full=Nuclear factor NF-kappa-B inhibitor kinase beta; Short=NFKBIKB; AltName: Full=Serine/threonine protein kinase IKBKB
MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTH
PNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENR
IIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGT
LAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLM
LMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEED
QELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN
LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSI
QIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMALQTDIVDLQRSPMGRKQGGTL
DDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLSKTVVCKQKALELLPKVE
EVVSLMNEDEKTVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPE
PAKKSEELVAEAHNLCTLLENAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS

(base) ngs@NU-NGS:~/Downloads$ #! /bin/bash
(base) ngs@NU-NGS:~/Downloads$ vim seq
(base) ngs@NU-NGS:~/Downloads$ bash seq
pos=1
pos=7
(base) ngs@NU-NGS:~/Downloads$ vim q3
(base) ngs@NU-NGS:~/Downloads$ bash q3
q3: line 4: syntax error near unexpected token `|'
q3: line 4: `exist=(echo "$seq" | grep -i "$query")'


#!/bin/bash
seq="$1"
query="$2"exist=(echo "$seq" | grep -i "$query")
revComp=$(echo "$seq" > tr "nacgtNACGT" "ntgcaNTGCA" | rev)
exist_rc=$(echo "$revComp" | grep -i "$query")
if [ "$exist" ] |  [ "$exist_rc" ];then
  echo "query exist"
fi
error in line 4 at exist ...........

how to fix it please???????

display. • 391 views
ADD COMMENT
0
Entering edit mode

What are you trying to do?

ADD REPLY
0
Entering edit mode

Are you searching for nucleotide motif in a protein sequence? Your sequence is protein/AA sequence and your search strings are NT motifs.

ADD REPLY

Login before adding your answer.

Traffic: 2438 users visited in the last hour
Help About
FAQ
Access RSS
API
Stats

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.

Powered by the version 2.3.6