High-throughput classification of amino acid differences in protein sequence alignment
1
0
Entering edit mode
7 months ago

Hi,

I am looking for a way to take a pairwise alignment and output the amino acid modification. For example, the sequences could be:

>seq1
MYPROT

>seq2
MYYROT

The desired output would be: P3Y

I have hundreds of protein sequences so I'd like something high-throughput because doing this by eye is tedious and error-prone.

Any help is greatly appreciated!

pairwise alignment protein amino acid • 384 views
ADD COMMENT
3
Entering edit mode
7 months ago
Mensur Dlakic ★ 20k

This may not be exactly what you want, but it should give you a solid starting point. Below are two sequences (maybe save them into test.fas), of which the second is mutated randomly in 7 positions compared to first:

>rseq_000000
CLDHEASRFAMPMQYDRAVEQCCNIHVNIDTLPASRAQLGQYTDPTGGVF
LPHPDRVAEGDCRQCNLDDVKSTGVMEFSCNGQSTSPSSSAVTSPVHACL
VMGSSFHYNEAALRTHNLDHEEFCATAITDSSQDQKIAKTELVQESYRED
ALIGMKEPRAQPVGRPRDPCASPVKRRKLVPNIVSTHYKCACQVKKNCPD
EPTRNGLFRVEGLNEGKPGSQIVGGGRSKGVQSSIIDSPTSSEGGIPRVV
PPGLSPSPLETISREECHAQETLIDRRSLQQAEYNAPHQYPMIKEPPGVQ
YDMKLQEELQTDRACFDQPSQDGYPMPDSLSSPGEAV
>rseq_000000_mut
CLDHNASRFAMPMQYDRAVEQCCNIHVNIDTLPASRAQLGQYTDPTGGVF
LPHSDRVAEGDCEQCNVDDVKSTGVMEFSCNGQSTSPSSSAVTSPVHACL
VMGSSFHYNEAALRTHNLDHEEFCATAITDSSQDQKIAKTELVQESYRED
ALIGMKEPRAQPVGRPREPCASPVKRRKLVPNIVSTHYKCACQVKKNCPD
EPTRNALFRVEGLNEGKPGSQIVGGGRSKGVQSSIIDSPTSSEGGIPRVV
PPGLSPSPIETISREECHAQETLIDRRSLQQAEYNAPHQYPMIKEPPGVQ
YDMKLQEELQTDRACFDQPSQDGYPMPDSLSSPGEAV

This short python code may be saved into file fasta_diff.py:

import sys
import numpy as np
from Bio import SeqIO

FastaFile = open(sys.argv[1], 'r')
store = np.array([])

for seqs in SeqIO.parse(FastaFile, 'fasta'):
    store = np.append(store, str(seqs.seq))

for z in range(len(store[0])):
    if store[0][z] != store[1][z]:
        print('%s' % (store[0][z]+str(z+1)+store[1][z]))

FastaFile.close()

Running python fasta_diff.py test.fas will produce the following output:

E5N
P54S
R63E
L67V
D168E
G206A
L259I
ADD COMMENT
0
Entering edit mode

Thank you Mensur!

ADD REPLY

Login before adding your answer.

Traffic: 1751 users visited in the last hour
Help About
FAQ
Access RSS
API
Stats

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.

Powered by the version 2.3.6