Showing:
single-cell rna seq • reset2
votes
2
answers
106
views
2
answers
Recent Votes
Recent Locations •
All »
- United Kingdom, just now
- European Union, 1 minute ago
- Germany, 1 minute ago
- Ankara/Turkey, 4 minutes ago
Recent Awards • All »
- Student to beausoleilmo • 180
- Teacher to Alice • 210
- Scholar to Pierre Lindenbaum ♦ 106k
- Voter to Bioinfo • 170
- Scholar to Alice • 210
- Teacher to Pierre Lindenbaum ♦ 106k
Recent Replies
-
A: conversion of DNA sequence to PDB format by
mbnobari • 0
>Q8YEK5 MSVNHAYAGPGIFINDGTDDGCIWTFDKEDYSPIGDYFGNTAPADKDSAGRNSPASVKYH IPSIQQLGGAATLKCLSKDRDTQTA...
-
C: Problem, getting information only from the last row and not from all the rows by
cpad0112 • 4.5k
what are the column (field) names? which one is frequency column and there are no genes in your e...
-
C: Strategy in WGS variant calling using GATK (CombineGVCF step) by
mostafarafiepour • 0
Hello, I also research the buffalo (River buffalo) whole genome sequencing data. I have 50 sampl...
-
C: Tophat output problem by
jrj.healey • 3.8k
Well, your first 2 problems are: 1) this is not a “tool” post, and 2) [don’t use tophat][1] [...
-
C: Note on DESeq2 by
Uday Madappa • 40
Oh, alright. Mine is 25 vs 25.
-
C: What is the name of this build What is equivalent to build37.fa.bz2 by
finswimmer • 1.4k
Correct. Please mark my answer as accepted if this is your solution. fin swimmer
-
C: BBSketch - A Tool for Rapid Sequence Comparison by
san62 • 0
What is the default kmer size for BBSketch?
-
C: How to use TCGA data for cancer prediction and prognosis ? by
Madil83 • 0
Hello, thanks for your answer! Could you please enlighten me on these preprocessing steps? Thank ...
-
C: Filtering a vcf based on known variants by
Alice • 210
What are your file formats? You can use bedtools to intersect variants with coordinates, it can w...
-
C: finding novel protein by
saadleeshehreen • 10
Thanks a lot . :) I will try Mauve
-
A: finding novel protein by
h.mon ♦ 13k
[Mauve][1] can read genbank files as input, you can align the genomes and the output window will ...
-
C: using biomaRt in R to annotate SNPs to Genes within 1000kb by
xiaohuichen03 • 0
Hi, I am working on this problem also. When I followed the step 4 using findOverlaps function in ...
Use of this site constitutes acceptance of our User
Agreement
and Privacy
Policy.
Powered by Biostar
version 2.3.0
Traffic: 1113 users visited in the last hour