User: radha.jg

gravatar for radha.jg
radha.jg0
Reputation:
0
Status:
New User
Last seen:
6 months, 1 week ago
Joined:
5 years, 6 months ago
Email:
r*******@gmail.com

Profile information, website and location are not shown for new users.

This helps us discourage the inappropriate use of our site.

Posts by radha.jg

<prev • 19 results • page 2 of 2 • next >
0
votes
1
answer
1.9k
views
1
answers
Comment: C: Exclude non coding sequences from multifasta
... the sequences are CDSs from tritrypdb and they usually have AUG as start codons. I'd like to keep it simple and can live without rare start codons beacuse its for use with codonW without sequences that trigger warnings ...
written 5.5 years ago by radha.jg0
1
vote
1
answer
1.9k
views
1
answers
Answer: A: Exclude non coding sequences from multifasta
... Things done so far from Bio import SeqIO infile= input('input fasta file') out = input('output fasta file') outFile =open(out,'rw') #Opens output file outFile =open(standarinput,'rw') ########################   Main Program   #################################### #opens and parse the fasta file a ...
written 5.5 years ago by radha.jg0
0
votes
1
answer
1.9k
views
1
answers
Comment: C: Exclude non coding sequences from multifasta
... I've started a pyton program like this: use Bio::SeqIO sequenceFile= open(standarinput,'ro') #con bioseq outFile =open(standarinput,'rw') for seq in sequenceFile:   if startAUG(seq):     if stopAtTheEnd(seq):       if NOTstopMiddle(seq):         outfile.print(seq)   def startAUG(seq):   #SOMETHI ...
written 5.5 years ago by radha.jg0
1
vote
1
answer
1.9k
views
1
answer
Exclude non coding sequences from multifasta
... Hello there I have a multifasta that have sequences with multiple stop codons and/or starts without AUG. How do I exclude those sequences? ...
gene sequence written 5.5 years ago by radha.jg0
0
votes
1
answer
2.3k
views
1
answers
Comment: C: make fasta sequences names short
... in case of sp_, how do I use an unique identifier like gi? I asume that $1 and $2 will do ...
written 5.5 years ago by radha.jg0
0
votes
1
answer
2.3k
views
1
answers
Comment: A: make fasta sequences names short
... I asume that $1 and $2 will do? ...
written 5.5 years ago by radha.jg0
0
votes
1
answer
2.3k
views
1
answers
Comment: A: make fasta sequences names short
... in case of sp_, how do I use an unique identifier like gi? ...
written 5.5 years ago by radha.jg0
0
votes
1
answer
2.3k
views
1
answers
Comment: A: make fasta sequences names short
... Exellent. Thank u very much. I seriously need to leran how to program in awk. ...
written 5.5 years ago by radha.jg0
1
vote
1
answer
2.3k
views
1
answer
make fasta sequences names short
... Hi, I'm a newbie so please be pacient. I have a fasta file like this: >gi|820716087|gb|AKG62099.1| eIF-2 alpha kinase [Leishmania donovani] MAKKKNECHSCRLVQAYNTCENDEIKDEIDIIVNTYENVRVSGKSAAHYRVLVPLTSESHPSRRVTLEIR VVPGYPYVVPAINLLFPPGLQPGCEGTLSEYEVKQMAKEVLNNIQPCLPSGMPCMMQIVSTVASIVECSI DPPSQQQNGKAQ ...
sequence written 5.5 years ago by radha.jg0

Latest awards to radha.jg

Popular Question 5.5 years ago, created a question with more than 1,000 views. For Is there a program better than CodonW for CAI?
Popular Question 5.5 years ago, created a question with more than 1,000 views. For Exclude non coding sequences from multifasta
Popular Question 5.5 years ago, created a question with more than 1,000 views. For make fasta sequences names short
Scholar 5.5 years ago, created an answer that has been accepted. For A: Exclude non coding sequences from multifasta

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 902 users visited in the last hour