User: nemo

gravatar for nemo
New User
Last seen:
7 months, 1 week ago
8 months, 2 weeks ago

Profile information, website and location are not shown for new users.

This helps us discourage the inappropriate use of our site.

Posts by nemo

<prev • 4 results • page 1 of 1 • next >
Comment: C: Error: NCBI C++ Exception: Error pre-fetching sequence data
... Hi lieven, yes, it seems there was no problem with makeblatdb. thank you for your suggestion. When I used old ver.(2.2.29), blast search was completed without any error! Thank you, ...
written 8 months ago by nemo0
Comment: C: Error: NCBI C++ Exception: Error pre-fetching sequence data
... Hi Thank you for your reply. hyphens come from our in-house developed program. yes, I noticed the messeage " CFastaReader: Hyphens are invalid and will be ignored around line 2". but this error is not the problem. I still have the same error (Error: NCBI C++ Exception:...) as 1291016966 mentioned a ...
written 8 months ago by nemo0
Comment: C: Error: NCBI C++ Exception: Error pre-fetching sequence data
... Thanks for your suggestion. I tried to run the blast with 5 threads and 10 threads. but I found a same error. I will try your other suggestion. ...
written 8 months ago by nemo0
Comment: A: Error: NCBI C++ Exception: Error pre-fetching sequence data
... Hi 1291016966, Did you solve the above problem? I got similar error when I run tblastn. In my case, the sequence below causes the error. >gi|1072238524|gb|OEU23251.1| MKQSVAAIVGTNNNADNLAVSASHLYSYESAVNALLSPGLHQSITKEDILKSSLRRTKTV ADMRYYWNKILKYNRHTNNVNTNDDDQKKNKKKPLLIHITGTKGKGSTACMCENILRSNG YKTGL ...
written 8 months ago by nemo0

Latest awards to nemo

No awards yet. Soon to come :-)


Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 548 users visited in the last hour