User: JJP

gravatar for JJP
JJP0
Reputation:
0
Status:
New User
Last seen:
1 week, 3 days ago
Joined:
1 week, 4 days ago
Email:
p********************@gmail.com

Profile information, website and location are not shown for new users.

This helps us discourage the inappropriate use of our site.

Posts by JJP

<prev • 1 results • page 1 of 1 • next >
0
votes
0
answers
92
views
0
answers
Clustal W multi sequence alignment with secondary structure constraints
... Hello, I am trying to align multiple sequences using constraints on secondary structure of one of the structures. Here are the sequences with secondary structures for one of them: seq1: NLLPYFDFDVPRNLTVTVGQTGFLHCRVERL GDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSY ...
multi-sequence alignment clustal w written 11 days ago by JJP0 • updated 11 days ago by RamRS19k

Latest awards to JJP

No awards yet. Soon to come :-)

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1623 users visited in the last hour