User: JJP

gravatar for JJP
JJP0
Reputation:
0
Status:
New User
Last seen:
2 months, 2 weeks ago
Joined:
5 months, 2 weeks ago
Email:
p********************@gmail.com

Profile information, website and location are not shown for new users.

This helps us discourage the inappropriate use of our site.

Posts by JJP

<prev • 2 results • page 1 of 1 • next >
0
votes
0
answers
326
views
0
answers
Find mapping of indices of amino acid index in PDB files and sequence
... Hi All, I am a beginner in Biopython. What I am trying to do is the following: I have a sequence of amino acids (including gaps)and a corresponding PDB file. The numbering of amino acids in the PDB file does not match the numbering of the amino acids in the sequence list. I want to find the index ...
pdb python sequence written 3 months ago by JJP0 • updated 3 months ago by natasha.sernova3.4k
0
votes
0
answers
222
views
0
answers
Clustal W multi sequence alignment with secondary structure constraints
... Hello, I am trying to align multiple sequences using constraints on secondary structure of one of the structures. Here are the sequences with secondary structures for one of them: seq1: NLLPYFDFDVPRNLTVTVGQTGFLHCRVERL GDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSY ...
clustal w multi-sequence alignment written 5 months ago by JJP0 • updated 5 months ago by RamRS21k

Latest awards to JJP

No awards yet. Soon to come :-)

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1890 users visited in the last hour