User: JJP

gravatar for JJP
New User
Last seen:
4 days, 17 hours ago
2 months, 2 weeks ago

Profile information, website and location are not shown for new users.

This helps us discourage the inappropriate use of our site.

Posts by JJP

<prev • 2 results • page 1 of 1 • next >
Find mapping of indices of amino acid index in PDB files and sequence
... Hi All, I am a beginner in Biopython. What I am trying to do is the following: I have a sequence of amino acids (including gaps)and a corresponding PDB file. The numbering of amino acids in the PDB file does not match the numbering of the amino acids in the sequence list. I want to find the index ...
pdb python sequence written 12 days ago by JJP0 • updated 12 days ago by natasha.sernova3.2k
Clustal W multi sequence alignment with secondary structure constraints
... Hello, I am trying to align multiple sequences using constraints on secondary structure of one of the structures. Here are the sequences with secondary structures for one of them: seq1: NLLPYFDFDVPRNLTVTVGQTGFLHCRVERL GDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSY ...
clustal w multi-sequence alignment written 10 weeks ago by JJP0 • updated 10 weeks ago by RamRS20k

Latest awards to JJP

No awards yet. Soon to come :-)


Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 2300 users visited in the last hour