User: ravila

gravatar for ravila
ravila0
Reputation:
0
Status:
New User
Twitter:
@ravila_4
Last seen:
6 days, 5 hours ago
Joined:
1 month ago
Email:
r*****@protonmail.com

Profile information, website and location are not shown for new users.

This helps us discourage the inappropriate use of our site.

Posts by ravila

<prev • 3 results • page 1 of 1 • next >
1
vote
1
answer
122
views
1
answer
What is 'reverse' blast, and when to use it?
... I have heard about 'reverse' blast searches, such as using RPS-BLAST. According to the website, > RPS-BLAST (Reverse PSI-BLAST) searches a query sequence against a > database of profiles. This is the opposite of PSI-BLAST that > searches a profile against a database of sequences, henc ...
rps-blast reverse blast blast written 24 days ago by ravila0 • updated 24 days ago by Mensur Dlakic480
0
votes
1
answer
132
views
1
answers
Comment: C: Help making a blast database with longer sequence IDs
... Thanks! That solved the issue. ...
written 4 weeks ago by ravila0
2
votes
1
answer
132
views
1
answer
Help making a blast database with longer sequence IDs
... I am trying to create a BLAST database with protein chain sequences. My FASTA looks like this: >1fig_1 ENVLTQSPAIMSASPGEKVTMACRASSSVSSTYLHWYQQKSGASPKLLIYSTSNLASGVP ARFSGS >1p8v_2 EADCGLRPLFEKKSLEDKTERELLESYID >5ivx_13 MSHSLRYFVTAVSRPGFGEPRYMEVGYVDNTEFVRFDSDAENP ...
mkblastdb fasta sequence protein blast written 4 weeks ago by ravila0

Latest awards to ravila

No awards yet. Soon to come :-)

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1203 users visited in the last hour