User: pedro19ms

gravatar for pedro19ms
pedro19ms20
Reputation:
20
Status:
New User
Location:
Last seen:
1 week, 4 days ago
Joined:
3 months, 2 weeks ago
Email:
p********@hotmail.com

Posts by pedro19ms

<prev • 4 results • page 1 of 1 • next >
0
votes
2
answers
123
views
2
answers
Comment: C: How to extract a peptide sequence (interval) from a FASTA file?
... Thank very you! I made some minor adjustments and it worked perfectly! ...
written 11 days ago by pedro19ms20
5
votes
2
answers
123
views
2
answers
How to extract a peptide sequence (interval) from a FASTA file?
... Hello, I have two files: 1. `sequences.fasta` 2. `intervals.txt` I used the "seqinR" package to obtain the protein sequences of interest (~ 3500 proteins sequences) and saved them to "sequences.fasta": > sp | O94827 | PKHG5_HUMAN MDDQSPAEKKGLRCQNPACMDKGRAAKVCHHADCQQLHRRGPLNLCEACDSKFHS ...
R written 12 days ago by pedro19ms20 • updated 12 days ago by bioinformatics2020340
1
vote
1
answer
111
views
1
answers
Comment: C: Multiple comparisons in proteomic data
... Thank you very much Kevin. It worked perfectly and in a few minutes I received my answer. I am relieved! ...
written 3 months ago by pedro19ms20
3
votes
1
answer
111
views
1
answer
Multiple comparisons in proteomic data
... Hello. I have a question about the application of the dunn.test function. I'm new to R and sorry if this question is basic. I have cancer proteomics data, I have four groups: CTRL (n = 8), GBM1 (n = 6), GBM2 (n = 6), GBM3 (n = 6). I need to know which proteins are regulated differently between grou ...
R written 3 months ago by pedro19ms20 • updated 3 months ago by Kevin Blighe63k

Latest awards to pedro19ms

No awards yet. Soon to come :-)

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1398 users visited in the last hour