User: saikishoremudhiraj2311

Reputation:
0
Status:
New User
Last seen:
1 month ago
Joined:
1 month ago
Email:
s*********************@gmail.com

Profile information, website and location are not shown for new users.

This helps us discourage the inappropriate use of our site.

Posts by saikishoremudhiraj2311

<prev • 6 results • page 1 of 1 • next >
0
votes
0
answers
99
views
0
answers
possible method to draw a 3D structure by PDB or Blast or swiss model
... I think Homology modeling predicts the 3D structure compared to protein threading, but I do have one question like is that possible to draw a 3D structure by PDB or Blast or swiss model or any combination of these tools. ...
homology written 5 weeks ago by saikishoremudhiraj23110
0
votes
0
answers
135
views
0
answers
Comment: C: Could any one explain about the pairwise alignment matrix.
... thanks for your feedback. I think Homology modeling predicts the 3D structure of a query protein through the sequence alignment of template protein whereas with protein threading, for full 3-D threading, the problem of identifying the best alignment is very difficult (it is an NP-hard problem for so ...
written 5 weeks ago by saikishoremudhiraj23110
0
votes
0
answers
135
views
0
answers
Comment: C: could any one explain about the pairwise alignment matrix. I'm struggling hard e
... its not a pairwise alignment i am sorry ...
written 5 weeks ago by saikishoremudhiraj23110
0
votes
0
answers
135
views
0
answers
Comment: A: could any one explain about the pairwise alignment matrix. I'm struggling hard e
... I have done the swiss model and i got Template as 3wa5.1.B Seq Identity as 26.98% Coverage Description Tse3-specific immunity protein Crystal Structure of type VI peptidoglycan muramidase effector Tse3 in complex with its cognate immunity protein Tsi3 ![enter image description here][1] https: ...
written 5 weeks ago by saikishoremudhiraj23110
0
votes
0
answers
135
views
0
answers
Comment: C: could any one explain about the pairwise alignment matrix. I'm struggling hard e
... Its a home work, i m trying to learn it ...
written 5 weeks ago by saikishoremudhiraj23110
1
vote
0
answers
135
views
0
answers
Could any one explain about the pairwise alignment matrix.
... d. You are given this FASTA Sequence: >Q8TAX7_Protein MKTLPLFVCICALSACFSFSEGRERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPPSSSAPPETTAAPPTPSATTQAPPSSSAPPETTAAPPTPPATTPAPPSSSAPPET ...
gene alignment sequence written 5 weeks ago by saikishoremudhiraj23110 • updated 5 weeks ago by h.mon31k

Latest awards to saikishoremudhiraj2311

No awards yet. Soon to come :-)

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1251 users visited in the last hour