User: Jason Lin

gravatar for Jason Lin
Jason Lin0
Reputation:
0
Status:
New User
Last seen:
5 years, 5 months ago
Joined:
5 years, 7 months ago
Email:
j********@rutgers.edu

Profile information, website and location are not shown for new users.

This helps us discourage the inappropriate use of our site.

Posts by Jason Lin

<prev • 8 results • page 1 of 1 • next >
2
votes
1
answer
2.5k
views
1
answer
how to compare sets using python (dealing with PDB file)
... Hi all,   Sorry to bother you all again. so I have a text file which contains the PDBID and corresponding missing coordinates from PDB file. Such as: 1FZ2 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 1FZ4 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 1FZ5 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 1FZ8 1 2 3 4 5 ...
pdb python set seg written 5.5 years ago by Jason Lin0 • updated 5.5 years ago by dariober10k
0
votes
1
answer
1.2k
views
1
answers
Comment: C: How to sort PDB name
... Thank you so much! Since I'm using mac and sort in terminal really helped! ...
written 5.5 years ago by Jason Lin0
3
votes
1
answer
1.2k
views
1
answer
How to sort PDB name
... Hey guys,             So I have a file contains PDB ID and SEG signal regions. which looks like this: 1JCE  339 340 341 342 343 344  1RQE 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539  1VRA  7 8 9 10 11 12  186 187 188 189 190 191 192 193 194 195 196 197 198 199  2H17  3 ...
pdb python name sort written 5.5 years ago by Jason Lin0 • updated 5.5 years ago by David Fredman990
0
votes
1
answer
2.4k
views
1
answer
how to compare protein sequence in Python
... Hi there, So I have lists which contain the PDBID for protein sequence and protein sequence such as:     >102L MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL     >103L MNIF ...
python sequence protein lists written 5.5 years ago by Jason Lin0 • updated 5.5 years ago by João Rodrigues2.5k
0
votes
1
answer
2.8k
views
1
answers
Comment: C: How to create a dataset using sequence file in python
... It helped. But for this I still don't understand how to solve number 2 and 3 in my goal. which is the total number of missing coordinates and the range of those missing coordinates. ...
written 5.5 years ago by Jason Lin0
0
votes
1
answer
2.8k
views
1
answer
How to create a dataset using sequence file in python
... I have a protein sequence file looks like this:     >102L:A MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL       ---------------------------------------------------------------- ...
table python dataset bioinformatics written 5.5 years ago by Jason Lin0 • updated 5.5 years ago by Zhaorong1.2k
2
votes
1
answer
1.5k
views
1
answer
How to align disorder region and sequence in a larger scale (python)
... So this is a follow up to my previous question. Thanks to @mdml. My previous question about How to align and compare two elements (sequence) in a list using python have been solved. Here is the code that I'm using (Code credit to mdml): # Parse the file which was already split into split_list line ...
python protein sequene bioinformatics written 5.5 years ago by Jason Lin0 • updated 5.2 years ago by Biostar ♦♦ 20
4
votes
3
answers
1.6k
views
3
answers
Bioinformatics Q: How to align and compare two elements (sequence) in a list using python
... here is my question: I've got a file which looks like this: 103L Sequence: MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNSLDAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKNL Disorder: ----------------------------------XXXXXX----- ...
python list protein sequence alignment written 5.5 years ago by Jason Lin0 • updated 5.5 years ago by Matt Shirley9.2k

Latest awards to Jason Lin

Autobiographer 5.6 years ago, has more than 80 characters in the information field of the user's profile.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1664 users visited in the last hour