User: tlorin

gravatar for tlorin
tlorin150
Reputation:
150
Status:
Trusted
Location:
Switzerland
Last seen:
2 hours ago
Joined:
2 years, 1 month ago
Email:
t***************@orange.fr

Posts by tlorin

<prev • 33 results • page 1 of 4 • next >
1
vote
1
answer
70
views
1
answers
Comment: C: Fasta to gff with custom set of genes
... `I don't agree completely. If your reads are RNASeq reads and you map them against a transcriptome, it shouldn't be a problem.` Definitely! Was just saying that you have to map your reads to a whole genome or transcriptome, not to "simply" 100 or 200 genes. ...
written 4 days ago by tlorin150
2
votes
1
answer
70
views
1
answer
Fasta to gff with custom set of genes
... Dear all, I have a custom list of 100 genes that I manually curated to obtain the full CDS and I would like to make differential expression (DE) analysis between samples for this very subset. I now I cannot simply map all the reads onto this subset and perform DE analysis because I would have [norm ...
fasta genome gff deseq2 rna-seq written 4 days ago by tlorin150 • updated 4 days ago by Macspider930
0
votes
2
answers
1.9k
views
2
answers
Comment: C: Why the local blast and online blast produce different results?
... Thanks for this solution @Juke-34. Indeed, the command line default parameter for `blastn` is 28, whereas the online default parameter is 11... ...
written 3 months ago by tlorin150
0
votes
1
answer
215
views
1
answers
Comment: C: Understanding NCBI identifiers
... I know that nr is supposed to be non-redundant (that's why I use it), but then why are there only 2 hits left (NP_001133180.1 and NP_001133181.1) when we blast the sequence onto the RefSeq database? Which one should I trust 'in general'? It seems to be that everyone has a 'feeling' about this but I ...
written 7 months ago by tlorin150
2
votes
1
answer
215
views
1
answer
Understanding NCBI identifiers
... This is kind of a general question regarding NCBI accesion numbers. Suppose I have this sequence >myseq MGQ-----NSPNLLR------LSQ --TLVGSSLLSSPSSPTTLKVKMPHAFPFLTPDQ-KKELSDIAHKIVAKGKGILAADES- --TGSVAKRFQSINTENTEENRRLYRQLLFTA-DERAGPCIGGVIFFHETLYQKTDAGKT FPEHVKSRGWVVGIKVDKGVVPLA ...
ncbi id written 7 months ago by tlorin150
0
votes
1
answer
330
views
1
answers
Comment: C: RepeatModeler cannot be run in parallel
... Haha I checked and I did install version 1.0.8 :) ...
written 7 months ago by tlorin150
0
votes
1
answer
330
views
1
answer
RepeatModeler cannot be run in parallel
... Dear all, I am trying to run RepeatModeler with multiple processors with the `-pa` option. I downloaded RepeatModeler (last version available [here][1]) and installed it properly (it runs perfectly but for a reaaaaaaaaaaaally long time). The documentation [here][2] and [here][3] says that I shoul ...
repeatmodeler repeatmasker written 7 months ago by tlorin150 • updated 4 days ago by cristina.osuna.cruz0
0
votes
3
answers
485
views
3
answers
Comment: C: download protein sequences from NCBI
... This should be better now, thanks! ...
written 8 months ago by tlorin150
1
vote
3
answers
485
views
3
answers
Answer: A: download protein sequences from NCBI
... [Here][1] is a well-explained tutorial for your problem :) [1]: http://www.ionsource.com/tutorial/db/tips_for_creating_species_specif.htm ...
written 8 months ago by tlorin150
0
votes
1
answer
460
views
1
answers
Comment: C: NCBI Blast locally: filter by accession number and NOT by GI number
... An alternative (and dirtier ;) ) possibility could be using [this][1], then using `makeblastdb` and blast on this newly created database. [1]: http://www.ionsource.com/tutorial/db/tips_for_creating_species_specif.htm ...
written 8 months ago by tlorin150

Latest awards to tlorin

Good Answer 3 months ago, created an answer that was upvoted at least 5 times. For A: Tajima's D value interpretation
Appreciated 6 months ago, created a post with more than 5 votes. For A: Tajima's D value interpretation
Popular Question 7 months ago, created a question with more than 1,000 views. For Fasta to axt - KaKs Calculator
Popular Question 17 months ago, created a question with more than 1,000 views. For Heatmap with categorical variables and with phylogenetic tree in R or Python
Scholar 17 months ago, created an answer that has been accepted. For A: Heatmap with categorical variables and with phylogenetic tree in R or Python
Supporter 19 months ago, voted at least 25 times.
Teacher 2.1 years ago, created an answer with at least 3 up-votes. For A: Heatmap with categorical variables and with phylogenetic tree in R or Python
Teacher 2.1 years ago, created an answer with at least 3 up-votes. For A: Heatmap with categorical variables and with phylogenetic tree in R or Python
Scholar 2.1 years ago, created an answer that has been accepted. For A: Heatmap with categorical variables and with phylogenetic tree in R or Python

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1450 users visited in the last hour