User: sharmatina189059

Reputation:
30
Status:
New User
Location:
United States
Last seen:
1 week ago
Joined:
3 years, 3 months ago
Email:
s***************@gmail.com

Posts by sharmatina189059

<prev • 102 results • page 1 of 11 • next >
0
votes
0
answers
96
views
0
answers
Comment: C: Discriminating ortholog and paralogs using Cd-hit
... ok.. let me try these tools.. thank you so much ...
written 10 days ago by sharmatina18905930
1
vote
0
answers
96
views
0
answers
Discriminating ortholog and paralogs using Cd-hit
... Dear all I have 40 genomes of bacterial and I need to identify ortholog and paralog genes along with core, dispensable and unique genes. I have used CD hit to make homologous gene clusters and calculate the genes in every cluster. 1- what to do for calculating core gene, accessory genes and unique ...
genome gene written 10 days ago by sharmatina18905930
0
votes
0
answers
52
views
0
answers
What does 16/304 MIC value mean?
... What does 16/304 MIC value mean? It is mentioned as measurement value in PATRIC database but what does it mean? ...
life sciences written 23 days ago by sharmatina18905930
0
votes
0
answers
75
views
0
answers
(Closed) How to change colors in heatmap according to the values?
... Dear all I am trying to generate a heatmap having values 0, 1, 2, 3 . I need different colors for these values and 3 has to be transparent. I am using below mentioned code with which heatmap is generated well but i am unable to change color pattern. Please help. library(heatmaply) heat ...
R written 6 weeks ago by sharmatina18905930 • updated 6 weeks ago by zx87546.6k
0
votes
0
answers
107
views
0
answers
How to draw gene architecture of bacterial genome using specific coordinates?
... Dear all I have a genome sequence for which i have a different coordinate file like this: AXXXX_XXXX 251962 252762 TnAs3 250165 250795 TnAs3 250791 250838 I need to make a figure representing the genome annotation of these 3 coordinates within min. coordinate range to max. coordinate range. How ca ...
genome written 12 weeks ago by sharmatina18905930
0
votes
1
answer
231
views
1
answers
Comment: C: Is there a tool for making a synteny blocks of a gene with its downstream and up
... Hi Sibelia is used for comparing only two genomes. I can not use it for multiple genomes. ...
written 12 weeks ago by sharmatina18905930
1
vote
1
answer
231
views
5 follow
1
answer
Is there a tool for making a synteny blocks of a gene with its downstream and upstream genes using a bacterial genome sequence?
... Dear all I have some protein sequences and bacterial genomes. I need to have a figure showing a block diagram of upstream and dowstream genes of that particular gene within multiple bacterial genome. Is there any tool for making a synteny of one gene in multiple genomes of bacteria? ...
genome written 12 weeks ago by sharmatina18905930 • updated 12 weeks ago by Joseph Hughes2.7k
0
votes
3
answers
276
views
3
answers
Comment: C: how to change fasta headers?
... But I have retrieved it from NCBI ftp site and the format is same. AM I doing some error? ...
written 5 months ago by sharmatina18905930
0
votes
3
answers
276
views
3
answers
Comment: C: how to change fasta headers?
... I have edited my post. Thanks!! ...
written 5 months ago by sharmatina18905930
0
votes
3
answers
276
views
3
answers
Comment: C: how to change fasta headers?
... and if the sequences are like >WP_000580188.1hypotheticalprotein[Acinetobacterbaumannii] MIGQQRNILATLGIDVWIPRTQVCQKNNAHTLWRDQVVEPHESITVPTIDVPAFEQKNTQPQVLEIPKVVEEPPIVVAEVSQPEILVEKPKVIEQETITPFELQAYCLEKCVIFVDVTALETEEKQLWANIQKAKVGQYSELRWPFPLAAYQDQRGVGSYIQGFLDAVAAEKKILCLGKCTYIQHANIIHLASLKEML ...
written 5 months ago by sharmatina18905930 • updated 5 months ago by finswimmer10k

Latest awards to sharmatina189059

Centurion 6 weeks ago, created 100 posts.
Popular Question 12 weeks ago, created a question with more than 1,000 views. For genbank file parsing
Popular Question 5 months ago, created a question with more than 1,000 views. For genbank file parsing
Popular Question 5 months ago, created a question with more than 1,000 views. For blast alignemnt query coverage

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1934 users visited in the last hour