User: sharmatina189059

Reputation:
30
Status:
New User
Location:
United States
Last seen:
6 days, 13 hours ago
Joined:
3 years, 1 month ago
Email:
s***************@gmail.com

Posts by sharmatina189059

<prev • 98 results • page 1 of 10 • next >
0
votes
0
answers
54
views
0
answers
How to draw gene architecture of bacterial genome using specific coordinates?
... Dear all I have a genome sequence for which i have a different coordinate file like this: AXXXX_XXXX 251962 252762 TnAs3 250165 250795 TnAs3 250791 250838 I need to make a figure representing the genome annotation of these 3 coordinates within min. coordinate range to max. coordinate range. How ca ...
genome written 11 days ago by sharmatina18905930
0
votes
1
answer
126
views
1
answers
Comment: C: Is there a tool for making a synteny blocks of a gene with its downstream and up
... Hi Sibelia is used for comparing only two genomes. I can not use it for multiple genomes. ...
written 12 days ago by sharmatina18905930
1
vote
1
answer
126
views
5 follow
1
answer
Is there a tool for making a synteny blocks of a gene with its downstream and upstream genes using a bacterial genome sequence?
... Dear all I have some protein sequences and bacterial genomes. I need to have a figure showing a block diagram of upstream and dowstream genes of that particular gene within multiple bacterial genome. Is there any tool for making a synteny of one gene in multiple genomes of bacteria? ...
genome written 12 days ago by sharmatina18905930 • updated 12 days ago by Joseph Hughes2.6k
0
votes
3
answers
201
views
3
answers
Comment: C: how to change fasta headers?
... But I have retrieved it from NCBI ftp site and the format is same. AM I doing some error? ...
written 11 weeks ago by sharmatina18905930
0
votes
3
answers
201
views
3
answers
Comment: C: how to change fasta headers?
... I have edited my post. Thanks!! ...
written 11 weeks ago by sharmatina18905930
0
votes
3
answers
201
views
3
answers
Comment: C: how to change fasta headers?
... and if the sequences are like >WP_000580188.1hypotheticalprotein[Acinetobacterbaumannii] MIGQQRNILATLGIDVWIPRTQVCQKNNAHTLWRDQVVEPHESITVPTIDVPAFEQKNTQPQVLEIPKVVEEPPIVVAEVSQPEILVEKPKVIEQETITPFELQAYCLEKCVIFVDVTALETEEKQLWANIQKAKVGQYSELRWPFPLAAYQDQRGVGSYIQGFLDAVAAEKKILCLGKCTYIQHANIIHLASLKEML ...
written 11 weeks ago by sharmatina18905930 • updated 11 weeks ago by finswimmer7.7k
0
votes
3
answers
201
views
3
answers
Comment: C: how to change fasta headers?
... Thanku so much it really works!! ...
written 11 weeks ago by sharmatina18905930
2
votes
3
answers
201
views
3
answers
how to change fasta headers?
... Dear all I have a file containing multiple fasta sequnces like >lcl|NZ_CP018664.1_prot_WP_000637306.1_3741 [locus_tag=AUO97_RS19225] [protein=hypothetical protein] [protein_id=WP_000637306.1] [location=complement(4001198..4001389)] [gbkey=CDS] MIVSNNFAVPYYLNVRKEKGMTAYYWATHQSQLALFDSYELAY ...
sequence written 11 weeks ago by sharmatina18905930 • updated 11 weeks ago by Hugo140
0
votes
1
answer
222
views
1
answers
Comment: C: how to download all protein sequnces of a bacteria using ncbi ftp site?
... I am running this command `ncbi-genome-download -l complete,chromosome bacteria --genus "Acinetobacter baumannii" --format protein-fasta` but this gives me MD5SUMS file names like this. I need fasta sequnces. 260ac38772d1f9d98641f03bc5b07596 ./GCF_000018445.1_ASM1844v1_assembly_report.txt ...
written 12 weeks ago by sharmatina18905930 • updated 12 weeks ago by jrj.healey9.1k
2
votes
1
answer
222
views
1
answer
how to download all protein sequnces of a bacteria using ncbi ftp site?
... How can I download all protein sequences of complete genome sequences of Acinetobacter baumannii from ncbi ftp site? ...
ncbi written 12 weeks ago by sharmatina18905930 • updated 12 weeks ago by jrj.healey9.1k

Latest awards to sharmatina189059

Popular Question 12 days ago, created a question with more than 1,000 views. For genbank file parsing
Popular Question 11 weeks ago, created a question with more than 1,000 views. For genbank file parsing
Popular Question 11 weeks ago, created a question with more than 1,000 views. For blast alignemnt query coverage

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 948 users visited in the last hour