User: sharmatina189059

Reputation:
30
Status:
New User
Location:
United States
Last seen:
3 hours ago
Joined:
2 years, 10 months ago
Email:
s***************@gmail.com

Posts by sharmatina189059

<prev • 95 results • page 1 of 10 • next >
0
votes
3
answers
100
views
3
answers
Comment: C: how to change fasta headers?
... But I have retrieved it from NCBI ftp site and the format is same. AM I doing some error? ...
written 7 hours ago by sharmatina18905930
0
votes
3
answers
100
views
3
answers
Comment: C: how to change fasta headers?
... I have edited my post. Thanks!! ...
written 8 hours ago by sharmatina18905930
0
votes
3
answers
100
views
3
answers
Comment: C: how to change fasta headers?
... and if the sequences are like >WP_000580188.1hypotheticalprotein[Acinetobacterbaumannii] MIGQQRNILATLGIDVWIPRTQVCQKNNAHTLWRDQVVEPHESITVPTIDVPAFEQKNTQPQVLEIPKVVEEPPIVVAEVSQPEILVEKPKVIEQETITPFELQAYCLEKCVIFVDVTALETEEKQLWANIQKAKVGQYSELRWPFPLAAYQDQRGVGSYIQGFLDAVAAEKKILCLGKCTYIQHANIIHLASLKEML ...
written 8 hours ago by sharmatina18905930 • updated 8 hours ago by finswimmer5.3k
0
votes
3
answers
100
views
3
answers
Comment: C: how to change fasta headers?
... Thanku so much it really works!! ...
written 9 hours ago by sharmatina18905930
2
votes
3
answers
100
views
5 follow
3
answers
how to change fasta headers?
... Dear all I have a file containing multiple fasta sequnces like >lcl|NZ_CP018664.1_prot_WP_000637306.1_3741 [locus_tag=AUO97_RS19225] [protein=hypothetical protein] [protein_id=WP_000637306.1] [location=complement(4001198..4001389)] [gbkey=CDS] MIVSNNFAVPYYLNVRKEKGMTAYYWATHQSQLALFDSYELAY ...
sequence written 10 hours ago by sharmatina18905930 • updated 7 hours ago by Hugo130
0
votes
1
answer
81
views
1
answers
Comment: C: how to download all protein sequnces of a bacteria using ncbi ftp site?
... I am running this command `ncbi-genome-download -l complete,chromosome bacteria --genus "Acinetobacter baumannii" --format protein-fasta` but this gives me MD5SUMS file names like this. I need fasta sequnces. 260ac38772d1f9d98641f03bc5b07596 ./GCF_000018445.1_ASM1844v1_assembly_report.txt ...
written 5 days ago by sharmatina18905930 • updated 5 days ago by jrj.healey6.7k
2
votes
1
answer
81
views
1
answer
how to download all protein sequnces of a bacteria using ncbi ftp site?
... How can I download all protein sequences of complete genome sequences of Acinetobacter baumannii from ncbi ftp site? ...
ncbi written 6 days ago by sharmatina18905930 • updated 6 days ago by jrj.healey6.7k
0
votes
0
answers
59
views
0
answers
How to use genewise using pubmed.mineR ?
... The example file is Genewise(x, "TLR4"). See the below mentioned link. https://rdrr.io/cran/pubmed.mineR/man/Genewise.html and in R studio, I am running Genewise(Abstracts, "TLR4"), getabs(Abstracts, "acinetobacter") ,Give_Sentences_PMC(PMC4039032, "atherosclerosis") and help(pubmed.mineR). But not ...
R written 15 days ago by sharmatina18905930
0
votes
1
answer
155
views
1
answers
Comment: C: Row and coloumn names do not display on x and Y axis in heatmaply.
... The query has now been resolved. Thank you so much. ...
written 11 weeks ago by sharmatina18905930
0
votes
1
answer
155
views
1
answers
Comment: C: Row and coloumn names do not display on x and Y axis in heatmaply.
... It works. Thank you so much... ...
written 11 weeks ago by sharmatina18905930

Latest awards to sharmatina189059

No awards yet. Soon to come :-)

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1906 users visited in the last hour