User: Jason

gravatar for Jason
Jason0
Reputation:
0
Status:
New User
Last seen:
1 month ago
Joined:
1 year ago
Email:
i******@gmail.com

Profile information, website and location are not shown for new users.

This helps us discourage the inappropriate use of our site.

Posts by Jason

<prev • 24 results • page 1 of 3 • next >
0
votes
1
answer
147
views
1
answers
Comment: C: grep only specific motif from whole protein sequence
... Hey, Thanks for help but I'm getting error. How can I resolve it awk: syntax error at source line 1 context is >>> {N=match($2,/(S....[FS]...L)/, <<< awk: illegal statement at source line 1 awk: illegal statement at source line 1 ...
written 6 weeks ago by Jason0 • updated 6 weeks ago by RamRS19k
2
votes
1
answer
147
views
1
answer
(Closed) grep only specific motif from whole protein sequence
... Hello All, How to Grep only specific motif from complete sequences in a fasta file using shell command? Also, I want to include the lines beginning with a > before these target sequences. I got help from the previous post in this link: https://www.biostars.org/p/339314/#339423 to grep whole sequ ...
sequencing written 6 weeks ago by Jason0 • updated 6 weeks ago by Pierre Lindenbaum114k
0
votes
3
answers
237
views
3
answers
Comment: C: grep whole sequences containing a specific motif in a fasta file
... It is working thank u ...
written 7 weeks ago by Jason0
0
votes
3
answers
237
views
3
answers
Comment: A: grep whole sequences containing a specific motif in a fasta file
... What about if I want to keep only sequences that don’t have the motif” SXXXX (F/S)XXXL” and save that in new fasta file: The result in that case should be only this sequence: sp|Q9re7.2|CARer_HUMAN RecName BKLSVLEGWRVTLTSVIDRFRITPYLRQTKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQRTGHKGYVAFLESLELYYPQLYKKVTGKEP ...
written 7 weeks ago by Jason0
0
votes
3
answers
237
views
3
answers
Comment: C: grep whole sequences containing a specific motif in a fasta file
... It was working. thank u so much ...
written 7 weeks ago by Jason0
9
votes
3
answers
237
views
6 follow
3
answers
grep whole sequences containing a specific motif in a fasta file
... How to Grep the complete sequences containing a specific motif in a fasta file using shell command? Also, I want to include the lines beginning with a `>` before these target sequences. I found this post :https://www.biostars.org/p/274859/ similar to my problem but I'm looking for different mot ...
sequencing written 7 weeks ago by Jason0 • updated 7 weeks ago by Malcolm.Cook850
2
votes
2
answers
223
views
5 follow
2
answers
Add string to list of protein sequences in fasta file with different lengh
... How can I do this using python or shell command: Suppose I have 200 protein sequences in fasta file named 'proto.fasta' with different lengths I want to find maximum length between these sequences and then I want to add one string (Z) to all other sequences at the end of them to make all sequences ...
sequencing written 10 weeks ago by Jason0 • updated 10 weeks ago by benformatics320
5
votes
2
answers
184
views
2
answers
reduce size of string
... Hello all I have txt file of 400 sequences. abcdtmrtnunzaeq ygbwwqwtsazpklf yuncspytaqwercl How can I write shell command to delete the first three letter and also delete the end of the three letter at each row and save that in new txt file Result should be save in new txt file like this: ...
python sequence shell written 6 months ago by Jason0 • updated 5 months ago by cpad01129.8k
0
votes
3
answers
408
views
3
answers
Comment: C: find difference sequences with different header
... Hi, I also tested your code. It gave me some sequences find in both file 1 and file 2. it will not save sequences in file1 that not find in file 2. The problem here some sequences in file 2 have different index but same identical sequences. That mean some sequences from file 2 will be in result. I ...
written 7 months ago by Jason0
0
votes
3
answers
408
views
3
answers
Comment: C: find difference sequences with different header
... Hi, This code will do same mistake because some sequences in file 2 have different id but same identical sequences in file 1. We get all sequences from file1 that do not match the IDs in common_ids and store the result in file3.fa, but the problem here some sequences in file 2 have different index ...
written 7 months ago by Jason0

Latest awards to Jason

No awards yet. Soon to come :-)

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1247 users visited in the last hour