User: Jason

gravatar for Jason
Jason0
Reputation:
0
Status:
New User
Last seen:
1 day, 18 hours ago
Joined:
6 months ago
Email:
i******@gmail.com

Profile information, website and location are not shown for new users.

This helps us discourage the inappropriate use of our site.

Posts by Jason

<prev • 16 results • page 1 of 2 • next >
0
votes
3
answers
186
views
3
answers
Comment: C: find difference sequences with different header
... Hi, I also tested your code. It gave me some sequences find in both file 1 and file 2. it will not save sequences in file1 that not find in file 2. The problem here some sequences in file 2 have different index but same identical sequences. That mean some sequences from file 2 will be in result. I ...
written 10 days ago by Jason0
0
votes
3
answers
186
views
3
answers
Comment: C: find difference sequences with different header
... Hi, This code will do same mistake because some sequences in file 2 have different id but same identical sequences in file 1. We get all sequences from file1 that do not match the IDs in common_ids and store the result in file3.fa, but the problem here some sequences in file 2 have different index ...
written 10 days ago by Jason0
0
votes
3
answers
186
views
3
answers
Comment: C: find difference sequences with different header
... Hello, After I made some analysis for many sequences I found this code will hold some common sequences in both file 1 and file 2 and save that in file 3 Find common sequences between file1 and file2 and extract ther IDs: seqkit common -s file1.fa file2.fa|grep '>'|cut -c2- > common_ids Ge ...
written 10 days ago by Jason0
0
votes
3
answers
186
views
3
answers
Comment: C: find difference sequences with different header
... Hey, This code did not do what I expect it. thanks ...
written 14 days ago by Jason0
0
votes
3
answers
186
views
3
answers
Comment: C: find difference sequences with different header
... Thank you so much for your hep ...
written 15 days ago by Jason0
0
votes
3
answers
186
views
3
answers
Comment: C: find difference sequences with different header
... Hey, I applied this code cat file1.fasta file2.fasta|seqkit rmdup -s -o file3.fa the result saved in file3 as : >NP_000009.1 very long-chain specific acyl-CoA dehydrogenase, mitochondrial isoform 1 precursor [Homo sapiens] MQAARMAASLGRQLLRLGGGSSRLTALLGQPRPGPARRPYAGGAAQLALDKSDSHPSDALTRK ...
written 15 days ago by Jason0 • updated 15 days ago by genomax46k
0
votes
3
answers
186
views
3
answers
Comment: C: find difference sequences with different header
... Hey, When I used this command it gave me this error and i'm sure about the name of files: cat file1.fasta file2.fasta|seqkit rmdup seqkit rmdup -s -o file3.fa [ERRO] fastx: open seqkit: no such file or directory How can I resolve this problem? If I change the command to this command cat file1.f ...
written 15 days ago by Jason0
2
votes
3
answers
186
views
3
answers
find difference sequences with different header
... I have two fasta file with 200 sequences. I want to use shell commands to find difference sequences with different headers between theses two fasta files and save that in new file with heder from file as output. this command find match sequences even if header is not same. it look at match sequenc ...
sequence written 15 days ago by Jason0 • updated 14 days ago by cpad01124.4k
0
votes
1
answer
176
views
1
answers
Comment: C: extract postion motif from fasta file
... I want to read many patterns with list of sequences. This software will only read one pattern for each run. thank you ...
written 5 weeks ago by Jason0
3
votes
1
answer
176
views
5 follow
1
answer
extract postion motif from fasta file
... Use shell command or python Suppose I have two files. The first file has more than 100 list of fasta file. The second file has list of motifs. I want to extract the postion of each string in the motifs and save that in txt file 3. Forexample: File 1: >sp|P26140|3BHS2_MOUSE 3 beta-hydrox ...
sequence written 5 weeks ago by Jason0 • updated 5 weeks ago by cpad01124.4k

Latest awards to Jason

No awards yet. Soon to come :-)

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 826 users visited in the last hour