User: jaqx008

gravatar for jaqx008
jaqx00840
Reputation:
40
Status:
New User
Location:
Last seen:
1 week ago
Joined:
11 months, 2 weeks ago
Email:
j******@gmail.com

Posts by jaqx008

<prev • 201 results • page 1 of 21 • next >
0
votes
0
answers
137
views
0
answers
Comment: C: How do I find adaptors for my miRNA seq data?
... I think I understand now and my fastq file seem to already trimmed. Thanks for your suggestions ...
written 7 days ago by jaqx00840
0
votes
0
answers
137
views
0
answers
Comment: C: How do I find adaptors for my miRNA seq data?
... Does it make sense now? sorry for unclear title ...
written 7 days ago by jaqx00840
0
votes
0
answers
137
views
0
answers
Comment: C: How is miRNA seq date made with ion Torrent cleaned?
... https://www.ncbi.nlm.nih.gov/sra/SRX2245299[accn] ...
written 7 days ago by jaqx00840
2
votes
0
answers
137
views
0
answers
How do I find adaptors for my miRNA seq data?
... Hello everyone, I downloaded a miRNA-seq data from NCBI and I want to clip the adaptor sequences, but the adaptor sequence used was not included in the experimental description. How do I find the adaptor sequence to usse for clipping the fastq data? the link to the page is https://www.ncbi.nlm.nih.g ...
ion torrent mirna-seq written 7 days ago by jaqx00840
0
votes
1
answer
125
views
1
answers
Comment: C: Recommendation on RNA-seq data for wild (untreated) Zebrafish developmental stag
... I came across this before but wasnt able to figure out what was what. Thanks for pointing out that the names are in the supplementary material1. Thanks ...
written 8 days ago by jaqx00840
1
vote
1
answer
125
views
1
answer
Recommendation on RNA-seq data for wild (untreated) Zebrafish developmental stages needed?
... Hello Everyone. I am looking for recommendations on were I can download good RNA-seq data for the developmental stages of the model organism, *Danio rerio*. I know this is available but my searches havent been able to yield what I am looking for. NCBI has a tone of sra for zebrafish but atleast all ...
danio rerio zebrafish mapping rna-seq sequencing written 10 days ago by jaqx00840
0
votes
1
answer
119
views
1
answers
Comment: C: How do I resolve this error when using tblastn -db?
... I did upvoted it. ...
written 10 days ago by jaqx00840
0
votes
1
answer
119
views
1
answers
Comment: C: How do I resolve this error when using tblastn -db?
... You were right. I copied the content into a new text file and got something out. thanks for your sugestion ...
written 10 days ago by jaqx00840
0
votes
1
answer
119
views
1
answers
Comment: C: How do I resolve this error when using tblastn -db?
... the content of the text file looks like this. I believe its a fasta >Cel-Ego1 MGDEGYRGWIKLEIPCSLPERQMGPIVKCHVAKLEPALNEYNIKVLTKGQVQVVEEQDCEPFYETNYEVATSRFSHDLIA AIQTYLKDLSTDHLMPFQRGNLVLHSSDFWSSELTCHLVDIPLAAVFFGNIQGGTFINHWEVSFWDDVRRRKSARTRNTE PTQADKIGMNQIKVEFEFDKIDFM ...
written 10 days ago by jaqx00840
0
votes
1
answer
119
views
1
answers
Comment: C: How do I resolve this error when using tblastn -db?
... file protein.txt gave protein.txt: data head protein.txt gave a binary looking file as outbut (just jagons inside I guess) ...
written 10 days ago by jaqx00840

Latest awards to jaqx008

Popular Question 9 weeks ago, created a question with more than 1,000 views. For python script error: ImportError: No module named pysam
Scholar 4 months ago, created an answer that has been accepted. For A: GREP: out of memory
Centurion 6 months ago, created 100 posts.
Rising Star 8 months ago, created 50 posts within first three months of joining.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 2163 users visited in the last hour