User: MB

gravatar for MB
MB20
Reputation:
20
Status:
New User
Location:
Last seen:
1 day, 7 hours ago
Joined:
10 months ago
Email:
m***********@gmail.com

Posts by MB

<prev • 18 results • page 1 of 2 • next >
0
votes
2
answers
89
views
2
answers
Comment: C: How to rename duplicate fasta headers after the first underscore '_'?
... Thanks, worked like a charm! ...
written 10 days ago by MB20
0
votes
2
answers
89
views
2
answers
Comment: C: How to rename duplicate fasta headers after the first underscore '_'?
... Thanks! worked perfectly! ...
written 10 days ago by MB20
5
votes
2
answers
89
views
2
answers
How to rename duplicate fasta headers after the first underscore '_'?
... Hi, I have a fasta file **input.fa** which has duplicate fasta headers. >UID584_Org_name_strain JGTTQEWEILYNMCCDASSHHGTQEFGRKKQLAADBNGTAVQEGFN >JGH1236_Org_name HFHGTSNNIGLTTREKKQLAADBNGTAVQEGFNMENDLALFVTYGAHLVDGNVLTDRLSIGGKTALTGVDP >JGH1236_Org_nam ...
fasta duplicate header sed awk written 10 days ago by MB20 • updated 10 days ago by Carambakaracho930
0
votes
1
answer
153
views
1
answers
Comment: C: How to extract organisms name from the headers in a multi-fasta file?
... It worked too! Thanks! ...
written 20 days ago by MB20
0
votes
1
answer
153
views
1
answers
Comment: C: How to extract organisms name from the headers in a multi-fasta file?
... Thanks, it worked! It is giving all the organisms names. ...
written 20 days ago by MB20
0
votes
1
answer
153
views
1
answers
Comment: C: How to extract organisms name from the headers in a multi-fasta file?
... Yes, these are all the possible formats for fasta headers in the input file. ...
written 20 days ago by MB20
6
votes
1
answer
153
views
1
answer
How to extract organisms name from the headers in a multi-fasta file?
... Hi, I am trying to extract organisms' names from the headers in a multi-fasta file named **input.fa** shown below: >KZR5864_Org_name_nam_strain.11 GHTKKLACWQRTTAAFFGYYWOPPEEDSSSSLKKDDIIPFTQWENMAATGGFDMLLAAPP >OIA4716.3_Org_other_name_bla_bla AHHTTIPLNCCWWETRQKLLSSNNNMTIPAHGFSS ...
fasta header sed regex written 20 days ago by MB20 • updated 20 days ago by finswimmer11k
0
votes
2
answers
314
views
2
answers
Comment: C: Extract specific fasta sequences from multiple multi-fasta files located in a di
... Thanks, that helped! ...
written 7 months ago by MB20
0
votes
2
answers
314
views
2
answers
Comment: C: Extract specific fasta sequences from multiple multi-fasta files located in a di
... Thanks for your answer. I will try to use grep command from seqkit. ...
written 7 months ago by MB20
5
votes
2
answers
314
views
2
answers
Extract specific fasta sequences from multiple multi-fasta files located in a directory using Perl.
... I have a fasta sequence in a file called "**seq.fasta**", which I want to search into multiple multi-fasta files located in a directory "**/home/fasta_sequences**" and print all the matching sequences to a file "**output.fasta**". **seq.fasta** file looks like: >KNH123.1_gallus_gallus N ...
fasta perl written 7 months ago by MB20 • updated 7 months ago by h.mon24k

Latest awards to MB

Supporter 4 days ago, voted at least 25 times.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1833 users visited in the last hour