User: MB

gravatar for MB
MB20
Reputation:
20
Status:
New User
Location:
Last seen:
1 month ago
Joined:
1 year, 4 months ago
Email:
m***********@gmail.com

Posts by MB

<prev • 19 results • page 1 of 2 • next >
0
votes
0
answers
86
views
0
answers
How to output colored alignment from clustal omega stand alone tool?
... Is there any way to output colored multiple sequence alignment from Clustal Omega? We can easily do that on its website but I am unable to find any such option in its stand-alone version. Or is there any other similar tool, which can do that. Any help would be appreciated. Thanks! ...
colored alignment clustal omega written 5 weeks ago by MB20
0
votes
2
answers
270
views
2
answers
Comment: C: How to rename duplicate fasta headers after the first underscore '_'?
... Thanks, worked like a charm! ...
written 6 months ago by MB20
0
votes
2
answers
270
views
2
answers
Comment: C: How to rename duplicate fasta headers after the first underscore '_'?
... Thanks! worked perfectly! ...
written 6 months ago by MB20
5
votes
2
answers
270
views
2
answers
How to rename duplicate fasta headers after the first underscore '_'?
... Hi, I have a fasta file **input.fa** which has duplicate fasta headers. >UID584_Org_name_strain JGTTQEWEILYNMCCDASSHHGTQEFGRKKQLAADBNGTAVQEGFN >JGH1236_Org_name HFHGTSNNIGLTTREKKQLAADBNGTAVQEGFNMENDLALFVTYGAHLVDGNVLTDRLSIGGKTALTGVDP >JGH1236_Org_nam ...
fasta duplicate header sed awk written 6 months ago by MB20 • updated 6 months ago by Carambakaracho1.6k
0
votes
1
answer
375
views
1
answers
Comment: C: How to extract organisms name from the headers in a multi-fasta file?
... It worked too! Thanks! ...
written 6 months ago by MB20
0
votes
1
answer
375
views
1
answers
Comment: C: How to extract organisms name from the headers in a multi-fasta file?
... Thanks, it worked! It is giving all the organisms names. ...
written 6 months ago by MB20
0
votes
1
answer
375
views
1
answers
Comment: C: How to extract organisms name from the headers in a multi-fasta file?
... Yes, these are all the possible formats for fasta headers in the input file. ...
written 6 months ago by MB20
6
votes
1
answer
375
views
1
answer
How to extract organisms name from the headers in a multi-fasta file?
... Hi, I am trying to extract organisms' names from the headers in a multi-fasta file named **input.fa** shown below: >KZR5864_Org_name_nam_strain.11 GHTKKLACWQRTTAAFFGYYWOPPEEDSSSSLKKDDIIPFTQWENMAATGGFDMLLAAPP >OIA4716.3_Org_other_name_bla_bla AHHTTIPLNCCWWETRQKLLSSNNNMTIPAHGFSS ...
fasta header sed regex written 6 months ago by MB20 • updated 6 months ago by finswimmer12k
0
votes
2
answers
488
views
2
answers
Comment: C: Extract specific fasta sequences from multiple multi-fasta files located in a di
... Thanks, that helped! ...
written 13 months ago by MB20
0
votes
2
answers
488
views
2
answers
Comment: C: Extract specific fasta sequences from multiple multi-fasta files located in a di
... Thanks for your answer. I will try to use grep command from seqkit. ...
written 13 months ago by MB20

Latest awards to MB

Supporter 6 months ago, voted at least 25 times.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1663 users visited in the last hour