Moderator: JC

gravatar for JC
JC9.5k
Reputation:
9,510
Status:
Trusted
Location:
Mexico
Website:
http://about.me/jcabal...
Scholar ID:
Google Scholar Page
Last seen:
8 hours ago
Joined:
7 years, 9 months ago
Email:
j*******************@gmail.com

Computational Biologist

Posts by JC

<prev • 851 results • page 1 of 86 • next >
1
vote
1
answer
58
views
1
answers
Comment: C: Missing data in matrix- need help with Neighbor Joining
... >I have a matrix where the distance between two of the taxa is unknown. Your matrix is not good, you need to have a distance for all your pairs. ...
written 2 days ago by JC9.5k
0
votes
1
answer
59
views
1
answers
Answer: A: Obtain population information of 1092 sample of the 1000 genome project
... You can use the [1000Genomes Data portal][1] [1]: https://www.internationalgenome.org/data-portal ...
written 2 days ago by JC9.5k
0
votes
0
answers
53
views
0
answers
Comment: C: Querying ENCODE for Cell-types with certain assays available?
... Did you read [this][1]? [1]: https://www.encodeproject.org/help/rest-api/ ...
written 2 days ago by JC9.5k
1
vote
2
answers
103
views
2
answers
Answer: A: Append TPM value to sequence header in FASTA file
... I'm not sure if this could work unless you properly provide examples, but here is a Perl script to do the job: #!/usr/bin/perl use strict; use warnings; my $tpm_file = "your_tpm.txt"; my $fasta_file = "your_Fasta.fa"; my $new_fasta = "output_fasta.fa"; my ...
written 2 days ago by JC9.5k
0
votes
2
answers
103
views
2
answers
Comment: C: Append TPM value to sequence header in FASTA file
... Yes, examples could be better to understand how complex/easy it is. ...
written 3 days ago by JC9.5k
1
vote
1
answer
123
views
1
answers
Comment: C: Blastn command line tab format gives duplicates
... yes, that will show the full alignment in sections, for example, if I modify a little a Ferroxidase: >AAM45881.1 multicopper ferroxidase [Chlamydomonas reinhardtii] MDSKEAAEPASVHVNVDVEAQKAQAQAEAAAKGGACATSGMSKGKIIVTSLVIFLGVAVGVGLGVGLGVG LKKDDGSSAYTSLDLGTGSGGGNTYFVAADKIQWNYAPSGRNKCFPPD ...
written 3 days ago by JC9.5k
0
votes
1
answer
123
views
1
answers
Comment: C: Blastn command line tab format gives duplicates
... No, -num_alignments still will show partial alignments in table format ...
written 4 days ago by JC9.5k
5
votes
1
answer
123
views
1
answers
Answer: A: Blastn command line tab format gives duplicates
... Those are not duplicates, those are partial alignments. ...
written 4 days ago by JC9.5k
1
vote
1
answer
84
views
1
answers
Answer: A: Correct reference for Platinum Genomes?
... The reference data from NCBI contains haplotype chromosomes and alternative regions. You can use the sequences from [GATK bundle][1] [1]: https://gatk.broadinstitute.org/hc/en-us/articles/360036212652 ...
written 9 days ago by JC9.5k
1
vote
1
answer
60
views
1
answers
Answer: A: Variation in Ensembl Chromosome ID
... That is a haplotype sequence, check https://www.ensembl.org/Help/Faq?id=291 for more information ...
written 9 days ago by JC9.5k

Latest awards to JC

Scholar 2 days ago, created an answer that has been accepted. For A: Best way to remove contaminants to get nuclear genome
Appreciated 2 days ago, created a post with more than 5 votes. For A: Programming Challenge - Synthetic Whole Genome Vcf
Teacher 4 days ago, created an answer with at least 3 up-votes. For A: What Do The Period . Symbols Mean In The Sequence Record Of A Fastq File
Scholar 18 days ago, created an answer that has been accepted. For A: Best way to remove contaminants to get nuclear genome
Teacher 8 weeks ago, created an answer with at least 3 up-votes. For A: What Do The Period . Symbols Mean In The Sequence Record Of A Fastq File
Scholar 8 weeks ago, created an answer that has been accepted. For A: Best way to remove contaminants to get nuclear genome
Scholar 9 weeks ago, created an answer that has been accepted. For A: Best way to remove contaminants to get nuclear genome
Teacher 9 weeks ago, created an answer with at least 3 up-votes. For A: What Do The Period . Symbols Mean In The Sequence Record Of A Fastq File
Teacher 10 weeks ago, created an answer with at least 3 up-votes. For A: What Do The Period . Symbols Mean In The Sequence Record Of A Fastq File
Popular Question 11 weeks ago, created a question with more than 1,000 views. For Bioinformatician, Cellnetix Pathology And Laboratories, Seattle, Wa
Scholar 3 months ago, created an answer that has been accepted. For A: Best way to remove contaminants to get nuclear genome
Teacher 3 months ago, created an answer with at least 3 up-votes. For A: What Do The Period . Symbols Mean In The Sequence Record Of A Fastq File
Teacher 4 months ago, created an answer with at least 3 up-votes. For A: What Do The Period . Symbols Mean In The Sequence Record Of A Fastq File
Scholar 4 months ago, created an answer that has been accepted. For A: Best way to remove contaminants to get nuclear genome
Teacher 4 months ago, created an answer with at least 3 up-votes. For A: What Do The Period . Symbols Mean In The Sequence Record Of A Fastq File
Teacher 4 months ago, created an answer with at least 3 up-votes. For A: What Do The Period . Symbols Mean In The Sequence Record Of A Fastq File
Scholar 4 months ago, created an answer that has been accepted. For A: Best way to remove contaminants to get nuclear genome
Teacher 4 months ago, created an answer with at least 3 up-votes. For A: What Do The Period . Symbols Mean In The Sequence Record Of A Fastq File
Scholar 4 months ago, created an answer that has been accepted. For A: Best way to remove contaminants to get nuclear genome
Scholar 5 months ago, created an answer that has been accepted. For A: Best way to remove contaminants to get nuclear genome
Teacher 5 months ago, created an answer with at least 3 up-votes. For A: What Do The Period . Symbols Mean In The Sequence Record Of A Fastq File
Teacher 5 months ago, created an answer with at least 3 up-votes. For A: What Do The Period . Symbols Mean In The Sequence Record Of A Fastq File
Teacher 6 months ago, created an answer with at least 3 up-votes. For A: What Do The Period . Symbols Mean In The Sequence Record Of A Fastq File
Scholar 6 months ago, created an answer that has been accepted. For A: Best way to remove contaminants to get nuclear genome
Teacher 6 months ago, created an answer with at least 3 up-votes. For A: What Do The Period . Symbols Mean In The Sequence Record Of A Fastq File

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1544 users visited in the last hour