User: arriyaz.nstu

gravatar for arriyaz.nstu
Reputation:
0
Status:
New User
Last seen:
2 days, 6 hours ago
Joined:
1 year ago
Email:
a***********@gmail.com

Profile information, website and location are not shown for new users.

This helps us discourage the inappropriate use of our site.

Posts by arriyaz.nstu

<prev • 8 results • page 1 of 1 • next >
0
votes
1
answer
69
views
1
answers
Comment: C: How to find the overlapping peptide from a list.
... It is working nicely. Thank you very much. ...
written 11 days ago by arriyaz.nstu0
3
votes
1
answer
69
views
1
answer
How to find the overlapping peptide from a list.
... I have the following sequence; **IRCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWG NGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMI** I used three tools/methods from the Immune Epitope Database (IEDB) to predict antigenic peptides from this se ...
sequence written 11 days ago by arriyaz.nstu0 • updated 11 days ago by Mensur Dlakic1.7k
0
votes
1
answer
91
views
1
answers
Comment: C: How to remove ambiguous amino acid code containing sequences from a Fasta file?
... Thank you very much. ...
written 12 days ago by arriyaz.nstu0
0
votes
1
answer
91
views
1
answers
Comment: C: How to remove ambiguous amino acid code containing sequences from a Fasta file?
... Thank you for your explanation. I am trying this code also. Please, suggest me the code to remove the whole sequence. ...
written 12 days ago by arriyaz.nstu0
0
votes
1
answer
91
views
1
answers
Comment: C: How to remove ambiguous amino acid code containing sequences from a Fasta file?
... Sorry to say, this is not working. The code supposed to exclude some sequences in the output file. But in output file number of sequences remain the same 396. I am not sure whether the code is removing the whole sequence or only the ambiguous amino acids. ...
written 12 days ago by arriyaz.nstu0
0
votes
1
answer
91
views
1
answers
Comment: C: How to remove ambiguous amino acid code containing sequences from a Fasta file?
... I will use these sequences for population conservancy analysis in the immune epitope database. ambiguous AA containing sequence cause error during this analysis. I don't know replacing ambiguous with X will work or not, I didn't try this approach. Ok please, also suggest me how I can replace ambiguo ...
written 12 days ago by arriyaz.nstu0
0
votes
1
answer
91
views
1
answers
Comment: C: How to remove ambiguous amino acid code containing sequences from a Fasta file?
... I want to remove the whole sequence which contain ambiguous AA code. ...
written 12 days ago by arriyaz.nstu0
1
vote
1
answer
91
views
1
answer
How to remove ambiguous amino acid code containing sequences from a Fasta file?
... I have a fasta file with 396 protein sequences (the header in one line and amino acid codes in several lines). Some of these sequences contain ambiguous or exceptional amino acid codes (e.g., B, J, O, U, Z, X, -- ). I want to remove sequences containing such code and generate a new fasta file. How I ...
sequence written 12 days ago by arriyaz.nstu0 • updated 12 days ago by Pierre Lindenbaum123k

Latest awards to arriyaz.nstu

No awards yet. Soon to come :-)

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1543 users visited in the last hour