User: imda

gravatar for imda
imda0
Reputation:
0
Status:
New User
Last seen:
5 hours ago
Joined:
5 months, 1 week ago
Email:
i***@xanum.uam.mx

Profile information, website and location are not shown for new users.

This helps us discourage the inappropriate use of our site.

Posts by imda

<prev • 26 results • page 1 of 3 • next >
0
votes
1
answer
76
views
1
answers
Comment: C: How to edit fasta header with underscores
... Dear cpad0112, Could you help me with the questions that I pointed out below. Thank you. ...
written 13 hours ago by imda0
1
vote
1
answer
76
views
1
answers
Comment: A: How to edit fasta header with underscores
... I appreciate your answers, your scripts worked well for some kinds of sequences but not for all. The problem is that the headers of my sequences are not uniform. I have thirteen kinds of sequences (from different species = different headers). I want to extract the headers to get the CDS from another ...
written 13 hours ago by imda0 • updated 2 hours ago by cpad011211k
3
votes
1
answer
76
views
1
answer
How to edit fasta header with underscores
... Hi everyone! I want to remove one part of my fasta headers, could somebody help me??? please I have this: ``` >Capsicum_annuum_cvCM334_CA01g24260 PREDICTED_ transmembrane 9 superfamily member 4-like [Solanum tuberosum] MIAWISFPAVPLNFFGKEVVFSFATAVDNPLHVDLATQNKTRPSCAKVKMKINLLGEFPKRINVGMRMKTREVKE ...
fasta written 1 day ago by imda0
2
votes
1
answer
83
views
1
answer
How to get the nsites parameter that is requiered to run r8s software and then CAFE?
... Hi there, I want to run CAFE but I have to produce an ultrametric tree. I am using r8s program. I got the tree from Orthofinder and therefore I have the alignments that were used to get the tree. My problem is that r8s program needs the number of sites in the sequences that were used to estimate t ...
gene genome alignment cafe written 20 days ago by imda0 • updated 17 days ago by Ben Fulton80
0
votes
1
answer
162
views
1
answers
Comment: C: Some script or program to create venn diagrams for Orthofinder results?
... For the singletons file I l obtained this file Orthogroups_UnassignedGenes.csv but it does not have the format for your program. Any idea how to re format it? OG0046733 Sopen07g010930.1 OG0046734 Sopen07g010940.1 For families.txt I got ...
written 22 days ago by imda0
2
votes
1
answer
88
views
1
answer
problem with SingleCopyOrthogroups
... Hello, I have run Orthofinder successfully. However, I am a little bit concern about my results. I have to say that I am very new at this. When I look out the file SingleCopyOrthogroups.txt I just found 78 orthogroups, and since my point of view, I do not know if they are very few or what? These ar ...
orthofinder genes genomes written 23 days ago by imda0 • updated 23 days ago by shelkmike130
0
votes
1
answer
162
views
1
answers
Comment: C: Some script or program to create venn diagrams for Orthofinder results?
... Thanks for the answer, I am trying to run your script. However, I do not find outputs such as singletons.txt and families.txt in Orthofinder, do you know if Orthofinder has a similar result? Best Ivan ...
written 24 days ago by imda0
1
vote
1
answer
162
views
1
answer
Some script or program to create venn diagrams for Orthofinder results?
... Some script or program to create venn diagrams for Orthofinder results? or maybe a Rscript? To be honest I am a begginer in R ...
genome annotation orthofinder family genes written 25 days ago by imda0 • updated 25 days ago by Philipp Bayer6.0k
0
votes
1
answer
104
views
1
answers
Comment: C: Do you know some script or program to plot the results from Interproscan?
... Nice I will try the program ...
written 25 days ago by imda0
0
votes
1
answer
104
views
1
answers
Comment: C: Do you know some script or program to plot the results from Interproscan?
... Yes all the summary statistics ...
written 25 days ago by imda0

Latest awards to imda

No awards yet. Soon to come :-)

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 747 users visited in the last hour