User: M.O.L.S

gravatar for M.O.L.S
M.O.L.S10
Reputation:
10
Status:
New User
Location:
Last seen:
1 day, 11 hours ago
Joined:
9 months ago
Email:
o***********@gmail.com

Posts by M.O.L.S

<prev • 18 results • page 1 of 2 • next >
0
votes
0
answers
39
views
0
answers
Question: How do I view data in pymol via Ipymol for visualisation in a Jupyter notebook?
... I am analysing protein data using Python programming language and Jupyter notebook. In the Terminal I have put an alias in a hidden file on the home directory entitled .bash_profile, in order to be able to open pymol directly from the Terminal . alias pymol=/folder/where/pymol/is/located/A ...
pymol jupyter idle python written 1 day ago by M.O.L.S10
0
votes
4
answers
4.3k
views
4
answers
Comment: C: How To Download Atomic Coordinates For A Specific Chain From A Pdb File?
... Can you put comments in that? ...
written 17 days ago by M.O.L.S10
0
votes
1
answer
1.6k
views
1
answers
Answer: A: In Biopython-PDB, please teach me about all atoms distance
... In order to get all atoms in a residue, you can either: use the unfold_entities function inside of the Selection module in Bio.PDB. If you want all of the atoms in a residue, this means that you use the target level "A" and the entity list is the the name of your residue. or Use the .get_list() ...
written 18 days ago by M.O.L.S10
3
votes
0
answers
347
views
0
answers
How to run the ViennaRNA package
... How do I run the ViennaRNA package according to the MacOS X distribution. It goes into the Downloads folder and then Nothing happens? ...
rna structure written 5 months ago by M.O.L.S10
1
vote
0
answers
202
views
0
answers
How to loop through to get the polypeptide sequences of multiple structures using Biopython Bio.PDB module.
... structureA = PDBParser().get_structure("2rheH", " 2rheH") PolypeptideBuilder = PPBuilder() for pp in PolypeptideBuilder.build_peptides(structureA): print(pp.get_sequence()) >>> ESVLTQPPSASGTPGQRVTISCTGSATDIGSNSVIWYQQVPGKAPKLLIYYNDLLPSGVSDRFSASKSGTSASLAISGLESEDEADYYC ...
python bio polypeptide bio.pdb written 5 months ago by M.O.L.S10
0
votes
4
answers
4.3k
views
4
answers
Answer: A: How To Download Atomic Coordinates For A Specific Chain From A Pdb File?
... First, Specify which chain you want to look at. Different PDB files may have different numbers of chains. Use the chain methods to get the atoms and atomic coordinates. If you are looking at multiple PDB files you have to find a way to wrap that together in a for loop. ...
written 5 months ago by M.O.L.S10
0
votes
0
answers
152
views
0
answers
(Closed) How to upload python modules into RMarkdown document?
... I would like to find out how I can use python in RMarkdown. I would like to generate a PDF document of python code and text, using R markdown. I also have some R code that I would like to include in different places. I want to input python code into Markdown and install all of the python package ...
python rmarkdown R rstudio biological written 5 months ago by M.O.L.S10
0
votes
1
answer
459
views
1
answers
Answer: A: How to calculate the fraction of bases that are different from the reference bas
... How to add headers to a dataframe? import pandas as pd print("These are the headers for the data:") TheTitle = [ "sequenceNam", "positio", "referenceBas", "readCoun", "readResult", "Qualit", " "] print(TheTitle) This program cannot read the entire mpileup output file from mpileup ...
written 6 months ago by M.O.L.S10
1
vote
1
answer
1.2k
views
1
answers
Answer: A: How to load data into R from an external hard drive?
... Thank you so much for your invaluable help, It is very much appreciated. So all in all, the answer is: In order to analyse data in R or RStudio it is important to use the setwd() command. setwd(location/on/computer/to/where/the/folder/is/located) This is which is a one word command to fi ...
written 7 months ago by M.O.L.S10
0
votes
1
answer
1.2k
views
1
answers
Comment: C: How to load data into R from an external hard drive?
... MacOS High Sierra version 10.13.6 ...
written 7 months ago by M.O.L.S10

Latest awards to M.O.L.S

Popular Question 9 weeks ago, created a question with more than 1,000 views. For How to load data into R from an external hard drive?
Scholar 7 months ago, created an answer that has been accepted. For A: How to read an mpileup file from Samtools into Python
Scholar 8 months ago, created an answer that has been accepted. For A: How to read an mpileup file from Samtools into Python

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1326 users visited in the last hour