User: waqaskhokhar999

Reputation:
80
Status:
Trusted
Location:
Last seen:
1 day, 17 hours ago
Joined:
7 years, 4 months ago
Email:
w**************@gmail.com

about me

Posts by waqaskhokhar999

<prev • 81 results • page 1 of 9 • next >
1
vote
0
answers
51
views
0
answers
Combine fasta files by matching partial header in specific format
... I have three fasta files reflecting protein sequences for each gene in xls format (space separated). The first column contains header, while the other column contains sequence. For example: File1: sample 1 2 3 4 5 6 BnaA03g18710D M A A A V S BnaA03g18710D_S25 M A A A V S BnaA03g187 ...
rna-seq written 2 days ago by waqaskhokhar99980
0
votes
1
answer
74
views
1
answers
Comment: C: Replace ambigious nucleotide with correct nucleotides
... Many thanks for this guidance, I have tried to work on regex but didn't get success, So I thought instead of finding the nucleotide sequence for ambiguous codon, I can start with CDS sequence that is coding for those codons and can sort out the ambiguous nucleotide. I understand the first point but ...
written 3 days ago by waqaskhokhar99980
3
votes
1
answer
74
views
1
answer
Replace ambigious nucleotide with correct nucleotides
... I have multi fasta nucleotide file, I am interested to replace the [ambigious nucleotides][1] (R, Y, S, K, e.t.c) with a possible combination of nucleotides and save both options. For example, the following nucleotide sequence (sudo example): >Seq1 ATGGKCRCCGCSGT Contain ambiguous nucle ...
next-gen rna-seq written 3 days ago by waqaskhokhar99980 • updated 3 days ago by RamRS26k
0
votes
1
answer
97
views
1
answers
Comment: C: Replace Ambigious codons with Amino acid sequences
... I would like to keep both combinations, in the sequence a the yag will become cag and codes for Q, while in the sequence b the yag will become tag and reflects stop codon (*) and the outputs would be like these: >ORF1_BnaA03g18710D_S45:82:1509_a MAAAVSTVGAINRAPLSLNGSGAGAASVPATTFLGKKVVTAS ...
written 5 days ago by waqaskhokhar99980 • updated 5 days ago by RamRS26k
2
votes
1
answer
97
views
1
answer
Replace Ambigious codons with Amino acid sequences
... I have two multi-fasta files, one contains nucleotide sequences, and a subset of nucleotide sequence for ORF1 is: >ORF1_BnaA03g18710D_S45:82:1509 ATGGCCGCCGCAGTTTCCACCGTCGGTGCCATCAACAGAGCTCCGTTGAGCTTGAACGGG TCAGGAGCAGGAGCTGCTTCAGTCCCAGCTACGACCTTCTTGGGAAAGAAAGTTGTAACC GCGTCGAGATTC ...
sequence rna-seq written 5 days ago by waqaskhokhar99980 • updated 5 days ago by Asaf7.2k
0
votes
5
answers
9.1k
views
5
answers
Comment: C: How to extract the longest orf?
... Can you please tell me how I can use get_longest_ORF_per_transcript.pl script, I have tried following command: perl TransDecoder-TransDecoder-v5.5.0/util/get_longest_ORF_per_transcript.pl input_file But got this error: Error, cannot parse header info: BnaA03g18710D_ref at TransDecoder-TransDeco ...
written 6 days ago by waqaskhokhar99980
0
votes
1
answer
69
views
1
answer
Extract longest ORF
... I have input file contains multiple nucleotide sequences in fasta format. I am using a standalone Linux version of [ORFfinder][1] using following command: /Path/ORFfinder -in /Path_to_input_file/input_file.fasta -s 0 -out output_fasta -outfmt 0 This generates output file containing all ORF, b ...
rna-seq written 6 days ago by waqaskhokhar99980 • updated 6 days ago by Fatima510
0
votes
1
answer
73
views
1
answers
Comment: C: Alternative of ORFFinder for multiple nucleotide sequences
... Many thanks, Can you please suggest me how I can design loop for it? ...
written 28 days ago by waqaskhokhar99980
2
votes
1
answer
73
views
1
answer
Alternative of ORFFinder for multiple nucleotide sequences
... I have a file that contains multiple sequences in Fasta format. I am interested to translate them and want only protein sequences for the longest ORF. I can do this using [ORFFinder][1] but I have to process each sequence individually as it doesn't support multiple sequences. Is there any alternati ...
orf translation rna-seq written 29 days ago by waqaskhokhar99980 • updated 29 days ago by genomax79k
0
votes
0
answers
150
views
0
answers
Comment: C: Find gene ids based on genome coordinates
... Many thanks for your response, I have checked the reason for ids that don't match. I have estimated the AS events from assemblies generated by stringtie. The coordinates in stringtie vary from TAIR10 coordinates, so I need to extract the gene coordinates from stringtie assembly and then have to assi ...
written 5 months ago by waqaskhokhar99980

Latest awards to waqaskhokhar999

Supporter 28 days ago, voted at least 25 times.
Popular Question 16 months ago, created a question with more than 1,000 views. For Alternative splicing events in transcriptomic data

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 755 users visited in the last hour