Entering edit mode
11.3 years ago
dxu108
•
0
I apologize in advance if this question is naive/simple. I am currently running the Open Babel command obspectrophore as follows:
obspectrophore -i tester.sdf
where tester.sdf is an SDF file generated from the following FASTA sequence:
MDAATTRVGLTDLTFRLLRESFADAVSWVAKNLPARPAVPVLSGVLLTGSDNGLTISGFDYEVSAEAQVG
Running the command above took 5+ minutes to complete. Is this normal or is there some way (using a different file format/modifying settings) that I can obtain faster spectrophore results?
Thanks in advance!
"On a personal computer equipped with an i7-5500U processor with 12 GB of main memory, the Open Babel version runs fastest, with an average calculation speed of 36 ± 2 ms/molecule." https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5842169/ This is most likely the speed with small molecule not large ones.