Question: SignalP, prop, secretomeP
0
gravatar for victorcana1991
16 months ago by
victorcana19910 wrote:

Hello

I am trying to run the prop program with the test file (./prop -g -s test/GDNF_HUMAN.fsa) but my output file is not the same as the output file of the test. It seems that even though I linked the Signalp program to prop the program is not using it. In the same way when I run secretomep the output files (NN score) comes out different compared to the test output file and I do not know if the same error is linked. What I can do. It goes both output files:

 programas_secretoma/prop-1.0c$./prop -s test/GDNF_HUMAN.fsa

ProP v.1.0b ProPeptide Cleavage Site Prediction #####

Furin-type cleavage site prediction (Arginine/Lysine residues) #####

211 GDNF_HUMAN
MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPD 80 KQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKIL 160 KNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI 240 ............................................................................P... 80 ................................................................................ 160 .......P........................................... 240

Signal peptide cleavage site predicted: none

Propeptide cleavage sites predicted: Arg(R)/Lys(K): 2

programas_secretoma/prop-1.0c$ less test/four.out

211 GDNF_HUMAN
MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPD 80 KQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKIL 160 KNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI 240 sssssssssssssssssss.........................................................P... 80 ................................................................................ 160 .......P........................................... 240

Signal peptide cleavage site predicted: between pos. 19 and 20: ASA-FP

Propeptide cleavage sites predicted: Arg(R)/Lys(K): 2

software error • 367 views
ADD COMMENTlink written 16 months ago by victorcana19910
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1592 users visited in the last hour