Entering edit mode
                    6.0 years ago
        mhfk2901
        
    
        ▴
    
    20
    Hello everyone. This is my first time posting questions here. I am new to the field of Bioinformatics and I don't really know how to use command lines well. I am trying to identify the position of START and STOP codon from my AUGUSTUS prediction but any attempt to do so using grep has been a failure so far. I did go through related questions but I don't really understand the command lines given.
Example of my gff output
# Predicted genes for sequence number 73 on both strands
# start gene g3
254 AUGUSTUS    gene    1   491 0.98    -   .   g3
254 AUGUSTUS    transcript  1   491 0.98    -   .   g3.t1
254 AUGUSTUS    intron  109 168 1   -   .   transcript_id "g3.t1"; gene_id "g3";
254 AUGUSTUS    CDS 1   108 0.98    -   1   transcript_id "g3.t1"; gene_id "g3";
254 AUGUSTUS    CDS 169 491 1   -   0   transcript_id "g3.t1"; gene_id "g3";
254 AUGUSTUS    start_codon 489 491 .   -   0   transcript_id "g3.t1"; gene_id "g3";
# protein sequence = [MSSRSLAALAVVGAVALCARSASASGVTSDTSGIAGQTYDYIVVGAGLAGTTVAARLAENSAISILLIEAGGDDRGNS
# QVYDIYEYAQAFNGPLDWAWQSDRGKVLHGGKTLGGSSSINGGHWTRGLNAQYDAMSSLLEDSEQ]
# end gene g3
###
#
If I can just extract the line 254 AUGUSTUS start_codon 489 491 . - 0 transcript_id "g3.t1"; gene_id "g3"; , that would be good enough for me.
you can simply use
grepcommand to extract the line.Yes, Prakash. I just realized that it was so easy to do so. Thank you!
This problem has been solved. Thank you