Question: Proteolysis Of A Protein Sequence
0
gravatar for karunaworah
15 months ago by
karunaworah0 wrote:

Can any one help me for a R script to break the protein sequences by enzymatic action.(trypsin). If trypsin breaks protein sequences at K and R, How can i get all the peptide fragments after cutting. K and R for a sequence. Input file is in Fasta format

Input File

sp|Q13515|BFSP2_CON-HUMAN Phakinin OS=Homo sapiens GN=BFSP2 PE=1 SV=1 MSERRVVVDLPTSASSSMPLQRRRASFRGPRSSSSLESPPASRTNAMSGLVRAPGVYVGT

sp|P15924|DESP_CON-HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTG TMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEI

Output like: All peptide between of length minimum 10 and max 20 sequnces.

GN=BFSP2

RVVVDLPTSASSSMPLQ RASFRGPRSSSSLESPPASRTNAMSGL KAPGVYVGT

R • 189 views
ADD COMMENTlink written 15 months ago by karunaworah0
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1359 users visited in the last hour
_