Problems running Roary
0
0
Entering edit mode
3 months ago
SushiRoll ▴ 120

Hi everyone!

I'm having problems running roary, I have a set of gff3 files and run:

roary -e -mafft *.gff3

as suggested in the manual but I get:

Cant open file: /home/service/data/14L9VpZJtx/DNA16.gff.proteome.faa(base)

I also tried running the same but with sudo even though in theory there should be no need and get the same message.

I've tried: roary -g -mafft -z *.gff3 to keep the temporary files but even if that works, and the temporary files are indeed retained, I still get the "Can't open .... " message.

At this point I checked the dependencies by using roary -a and get the following:

2024/01/04 15:39:35 Looking for 'Rscript' - found /usr/bin/Rscript
2024/01/04 15:39:35 Determined Rscript version is 3.6
2024/01/04 15:39:35 Looking for 'awk' - found 
2024/01/04 15:39:35 Looking for 'bedtools' - found 
2024/01/04 15:39:35 Determined bedtools version is 2.30 
2024/01/04 15:39:35 Looking for 'blastp' - found
2024/01/04 15:39:35 Determined blastp version is 2.13.0 
2024/01/04 15:39:35 Looking for 'grep' - found
2024/01/04 15:39:35 Optional tool 'kraken' not found in your $PATH 
2024/01/04 15:39:35 Optional tool 'kraken-report' not found in your $PATH 
2024/01/04 15:39:35 Looking for 'mafft' - found
2024/01/04 15:39:35 Determined mafft version is 7.453
2024/01/04 15:39:35 Looking for 'makeblastdb' - found
2024/01/04 15:39:35 Determined makeblastdb version is 2.13.0 
2024/01/04 15:39:35 Looking for 'mcl' - found
2024/01/04 15:39:35 Determined mcl version is 14-137
2024/01/04 15:39:35 Looking for 'parallel' - found
2024/01/04 15:39:35 Determined parallel version is 20220722
2024/01/04 15:39:35 Looking for 'prank' - found 
2024/01/04 15:39:35 Determined prank version is 170427
2024/01/04 15:39:35 Looking for 'sed' - found 
2024/01/04 15:39:35 Looking for 'cd-hit' - found 
Use of uninitialized value in concatenation (.) or string at /usr/perl5/Bio/Roary/External/CheckTools.pm line 131. 
2024/01/04 15:39:35 Determined cd-hit version is Use of uninitialized value in numeric lt (<) at /usr/perl5/Bio/Roary/External/CheckTools.pm line 132. 
2024/01/04 15:39:35 Roary needs cd-hit 4.6 or higher. Please upgrade and try again. 
2024/01/04 15:39:35 Looking for 'FastTree' - found 
2024/01/04 15:39:35 Determined FastTree version is 2.1
2024/01/04 15:39:35 Roary version 3.13.0

I feel that maybe it has something to do with the cd-hit version not being recognised as newer than 4.6 even if I have cd-hit 4.8.1.

Has anyone experienced something like this? Any suggestions would be greatly appreciated.

pangenome Roary • 534 views
ADD COMMENT
0
Entering edit mode

What does file /home/service/data/14L9VpZJtx/DNA16.gff.proteome.faa say?

ADD REPLY
0
Entering edit mode

Hey Ram

Thanks for the reply. Actually the file per se is not created in the temporary folder 14L9VpZJtx, I have DNA16.gff.proteome.faa.tmp.filtered instead and it is a protein multifasta:

> HFFBGCFM_00001
MIFFLYMYVCFASAVYIPELWPTHLRLRGSGFVNAVGRIVAVFTPYGVAALLTHYGSITV
FMVLGVMLLLCALVLSIFGIETRKVSLEEISEVN*
> HFFBGCFM_00002
MPPRALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGEAVIASQDWHPANHGS
FASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLHQKAIAAVFHKGENPLVDSY
SAFFDNGRRQKTSLDDWLRDHEIDELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRG
VNIQPQDSAHAFMEMSAAGATLYTLADWEETQG*

These are the first two lines as an example. The names of each protein do contain the > before HFFBGCFM_*, I just can't type it here without it being detected as a Blockquote starter.

ADD REPLY
0
Entering edit mode

You need a code fence (or the 101010 code button on the toolbar) to code-format the text that you need represented without markdown interpretation. I've done it for you this time.

ADD REPLY

Login before adding your answer.

Traffic: 2307 users visited in the last hour
Help About
FAQ
Access RSS
API
Stats

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.

Powered by the version 2.3.6