User: shome

gravatar for shome
shome0
Reputation:
0
Status:
New User
Last seen:
1 week ago
Joined:
4 years, 6 months ago
Email:
s**************@gmail.com

Profile information, website and location are not shown for new users.

This helps us discourage the inappropriate use of our site.

Posts by shome

<prev • 16 results • page 1 of 2 • next >
1
vote
0
answers
66
views
0
answers
Does DESeq2 can do hypothesis testing between multiple treatment groups or the tests just done between the genes ?
... I have five datasets from the samples where I am trying to compare the miRNA abundances between the control and different treatments. Is it possible to use DESeq 2 to do hypothesis testing to suggest there is a significant difference between the control and treatments or not ? ...
rna-seq written 14 days ago by shome0
0
votes
1
answer
188
views
1
answers
Comment: C: combine fasta sequences in combination from two different files
... Hi If my fasta headers contain lines like this : >A0A2I3MB61_PAPAN/29-158; >A0A2IB61_HUMAN/29-10; how to only merge the fasta inputs where the string between _ and / matches. For instance, the fasta sequences only should combine if both are from human or from papan else wont.. ...
written 4 months ago by shome0
0
votes
1
answer
188
views
1
answers
Comment: C: combine fasta sequences in combination from two different files
... Thank you it worked based on your and Pierre's input. ...
written 4 months ago by shome0
0
votes
1
answer
188
views
1
answers
Comment: C: combine fasta sequences in combination from two different files
... Hi @Pierre,is there anyway to do this if there are multiple lines per fasta record? ...
written 4 months ago by shome0
0
votes
1
answer
188
views
1
answers
Comment: C: combine fasta sequences in combination from two different files
... I need combined fasta sequences of entries from file 1 and file 2 to do a residue correlation analysis.Ok..I will check it out with biopython,but I thought it is possible with awk/unix.. ...
written 4 months ago by shome0
0
votes
1
answer
188
views
1
answers
Comment: C: combine fasta sequences in combination from two different files
... Hi Arup, Actually, I want to combine entry1 from file 1 with all possible entries of file2(and do the same for all entries of file) and save in output.fasta. Cat *.fasta will merge all fasta sequences no matter what... ...
written 4 months ago by shome0
9
votes
1
answer
188
views
6 follow
1
answer
combine fasta sequences in combination from two different files
... I have two files that look as follows: file 1 >sp|P0|H1_HUMAN dhj OS=Homo sapiens OX=9606 GN=CDH1 PE=1 SV=3 MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDCTGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG >sp|Q4|C1_RAT C-1 jkjk OS=Rattus norvegicus ...
fasta unix shell awk written 4 months ago by shome0 • updated 4 months ago by Pierre Lindenbaum129k
0
votes
0
answers
268
views
0
answers
Comment: C: No output when trying to obtain protein sequence from PDB file
... It is containing RNA structure.I want to get the RNA sequence out of it. ...
written 5 months ago by shome0
0
votes
0
answers
268
views
0
answers
No output when trying to obtain protein sequence from PDB file
... I am trying to obtain the sequence from the PDB file, but no output is given when I run the following code : from Bio import SeqIO from Bio.PDB import * import numpy as np with open("1a9l.pdb", "r") as handle: for record in Seq ...
pdb biopython written 5 months ago by shome0 • updated 5 months ago by genomax85k
0
votes
0
answers
159
views
0
answers
pymol script to only select 5 chains within a distance from a reference and save the selection
... I am generating 30 asymmetric units of a protein structure. Now, I want to select different combinations of 5 units which are 30 Angstroms away from the reference and save it as a different file. Here is the command I could work out till now : fetch 3q2v symexp sym,3q2v,(3q2v),30 select ...
python visualisation pymol pymol scripting written 8 months ago by shome0

Latest awards to shome

Popular Question 4.4 years ago, created a question with more than 1,000 views. For How to find chromosome coordinates based on gene locus

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1713 users visited in the last hour