User: Mike

gravatar for Mike
Mike1.0k
Reputation:
1,040
Status:
Trusted
Location:
UK
Last seen:
4 weeks, 1 day ago
Joined:
2 years, 7 months ago
Email:
m***@gmail.com

Posts by Mike

<prev • 189 results • page 1 of 19 • next >
0
votes
1
answer
300
views
1
answers
Comment: C: Eigen genes using WGCNA
... This script will give you name of genes in each module ...
written 29 days ago by Mike1.0k
0
votes
1
answer
300
views
1
answers
Comment: C: Eigen genes using WGCNA
... Agree with Kevin's point. you can try with this code to extract modules.. **Extract modules** module_colors= setdiff(unique(dynamicColors), "grey") for (color in module_colors){ module=SubGeneNames[which(dynamicColors==color)] write.table(module, paste("module_",color, ".t ...
written 4 weeks ago by Mike1.0k
0
votes
0
answers
186
views
0
answers
Pipeline for analysis Lexogen QuantSeq 3' mRNA-Seq data
... Hi All, I am looking pipeline for analysis Lexogen QuantSeq 3' mRNA-Seq data. I will be very grateful if you help me. regards ...
rna-seq lexogen 3'rnaseq written 5 weeks ago by Mike1.0k • updated 6 days ago by Biostar ♦♦ 20
0
votes
2
answers
475
views
2
answers
Answer: A: How to convert fasta file format to phylip file format
... I found a nice tutorial to build Phylogenetic Trees from fasta sequence... http://www.cbs.dtu.dk/courses/biosys/binfintro/phylogeny.php Step 1: Open the sequence file (fasta), select the entire file, and copy the sequences. Step 2 : Align the sequences in using the mafft server at EBI with def ...
written 8 weeks ago by Mike1.0k
0
votes
2
answers
475
views
2
answers
Comment: C: How to convert fasta file format to phylip file format
... Thanks cpad0112, yes I can read file in read.phylip function from phylotools but not from ggtree/ treeio. How can I build tree using this phylip file in phylotools. ...
written 8 weeks ago by Mike1.0k
0
votes
2
answers
475
views
2
answers
Comment: C: How to convert fasta file format to phylip file format
... Thanks Sej, thats my problem, how to generate phylip file (phylip alignment + newick string) to plotting in ggtree. ...
written 8 weeks ago by Mike1.0k
0
votes
2
answers
475
views
2
answers
Comment: C: How to convert fasta file format to phylip file format
... Thanks jrj.healey for your help, I have around 150 protein sequences, this is just toy/example data. ...
written 8 weeks ago by Mike1.0k
0
votes
2
answers
475
views
2
answers
Comment: C: How to convert fasta file format to phylip file format
... >proteinsA -------------------------------MGDSRDLCPHLDSIGEVTKEDLLLKSKGT CQSCGVTGPNLWACLQVACPYVGCGESFADHRT-------DKKPA-----LCKSY----- ------QKLVSEVWHKKRPSYVVP----- >proteinsB MTGSNSHITILTLKVLPHFESLGKQEKIPNKMSAFRNHCPHLDSVGEITKEDLIQKSLGT S--------------HVSFP----------- ...
written 8 weeks ago by Mike1.0k
0
votes
2
answers
475
views
2
answers
Comment: C: How to convert fasta file format to phylip file format
... It is not copied and pasted file , I downloaded from from EMBOSS seqret result page as per below... ![enter image description here][1] I have also MAFFT (alignment file) file but dont know how to use this file for generate tree. [1]: https://s8.postimg.cc/vqh06ewat/image.jpg ...
written 8 weeks ago by Mike1.0k
4
votes
2
answers
475
views
6 follow
2
answers
How to convert fasta file format to phylip file format
... Hi all, I have fasta sequence of some proteins and I want to convert fasta format to phylip file format to build phylogenetic tree using ggtree. I tried online EMBOSS seqret tool to convert fasta file to phylip format but I got error when i read in ggtree. my input sequence >proteinsA ...
fasta R phylogenetic tree phylip ggtree written 8 weeks ago by Mike1.0k • updated 5 weeks ago by Guangchuang Yu2.0k

Latest awards to Mike

Scholar 8 weeks ago, created an answer that has been accepted. For A: survival analysis question
Guru 11 weeks ago, received more than 100 upvotes.
Popular Question 3 months ago, created a question with more than 1,000 views. For clusterProfiler: Input file format
Popular Question 3 months ago, created a question with more than 1,000 views. For GSEA with TCGA data
Popular Question 6 months ago, created a question with more than 1,000 views. For clusterProfiler: Input file format
Popular Question 6 months ago, created a question with more than 1,000 views. For GSEA with TCGA data
Popular Question 8 months ago, created a question with more than 1,000 views. For clusterProfiler: Input file format
Popular Question 9 months ago, created a question with more than 1,000 views. For clusterProfiler: Input file format
Popular Question 10 months ago, created a question with more than 1,000 views. For clusterProfiler: Input file format
Popular Question 10 months ago, created a question with more than 1,000 views. For clusterProfiler: Input file format
Popular Question 10 months ago, created a question with more than 1,000 views. For GSEA with TCGA data
Popular Question 10 months ago, created a question with more than 1,000 views. For TCGA data: comparision in normal and tumor samples
Popular Question 10 months ago, created a question with more than 1,000 views. For GSVA analysis in R: How to use my geneset and expression data matrix in GSVA.
Student 11 months ago, asked a question with at least 3 up-votes. For Single Cell RNAseq data analysis protocol
Appreciated 12 months ago, created a post with more than 5 votes. For A: ChIP-seq. analysis Tutorial for Dummies
Good Question 12 months ago, asked a question that was upvoted at least 5 times. For Single Cell RNAseq data analysis protocol
Good Answer 12 months ago, created an answer that was upvoted at least 5 times. For A: ChIP-seq. analysis Tutorial for Dummies
Popular Question 12 months ago, created a question with more than 1,000 views. For HTSeq error when reading BAM file
Popular Question 12 months ago, created a question with more than 1,000 views. For clusterProfiler: Input file format
Popular Question 12 months ago, created a question with more than 1,000 views. For GSEA with TCGA data
Popular Question 13 months ago, created a question with more than 1,000 views. For HTSeq error when reading BAM file
Good Answer 13 months ago, created an answer that was upvoted at least 5 times. For A: ChIP-seq. analysis Tutorial for Dummies
Appreciated 13 months ago, created a post with more than 5 votes. For A: Single Cell RNAseq data analysis protocol
Teacher 13 months ago, created an answer with at least 3 up-votes. For C: Starting a career in Bioinformatics
Appreciated 15 months ago, created a post with more than 5 votes. For A: Single Cell RNAseq data analysis protocol

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1179 users visited in the last hour