User: Mike

gravatar for Mike
Mike1.0k
Reputation:
1,020
Status:
Trusted
Location:
UK
Last seen:
1 day, 6 hours ago
Joined:
2 years, 5 months ago
Email:
m***@gmail.com

Posts by Mike

<prev • 186 results • page 1 of 19 • next >
0
votes
1
answer
232
views
1
answers
Answer: A: How to convert fasta file format to phylip file format
... I found a nice tutorial to build Phylogenetic Trees from fasta sequence... http://www.cbs.dtu.dk/courses/biosys/binfintro/phylogeny.php Step 1: Open the sequence file (fasta), select the entire file, and copy the sequences. Step 2 : Align the sequences in using the mafft server at EBI with def ...
written 1 day ago by Mike1.0k
0
votes
1
answer
232
views
1
answers
Comment: C: How to convert fasta file format to phylip file format
... Thanks cpad0112, yes I can read file in read.phylip function from phylotools but not from ggtree/ treeio. How can I build tree using this phylip file in phylotools. ...
written 1 day ago by Mike1.0k
0
votes
1
answer
232
views
1
answers
Comment: C: How to convert fasta file format to phylip file format
... Thanks Sej, thats my problem, how to generate phylip file (phylip alignment + newick string) to plotting in ggtree. ...
written 1 day ago by Mike1.0k
0
votes
1
answer
232
views
1
answers
Comment: C: How to convert fasta file format to phylip file format
... Thanks jrj.healey for your help, I have around 150 protein sequences, this is just toy/example data. ...
written 1 day ago by Mike1.0k
0
votes
1
answer
232
views
1
answers
Comment: C: How to convert fasta file format to phylip file format
... >proteinsA -------------------------------MGDSRDLCPHLDSIGEVTKEDLLLKSKGT CQSCGVTGPNLWACLQVACPYVGCGESFADHRT-------DKKPA-----LCKSY----- ------QKLVSEVWHKKRPSYVVP----- >proteinsB MTGSNSHITILTLKVLPHFESLGKQEKIPNKMSAFRNHCPHLDSVGEITKEDLIQKSLGT S--------------HVSFP----------- ...
written 1 day ago by Mike1.0k
0
votes
1
answer
232
views
1
answers
Comment: C: How to convert fasta file format to phylip file format
... It is not copied and pasted file , I downloaded from from EMBOSS seqret result page as per below... ![enter image description here][1] I have also MAFFT (alignment file) file but dont know how to use this file for generate tree. [1]: https://s8.postimg.cc/vqh06ewat/image.jpg ...
written 1 day ago by Mike1.0k
3
votes
1
answer
232
views
5 follow
1
answer
How to convert fasta file format to phylip file format
... Hi all, I have fasta sequence of some proteins and I want to convert fasta format to phylip file format to build phylogenetic tree using ggtree. I tried online EMBOSS seqret tool to convert fasta file to phylip format but I got error when i read in ggtree. my input sequence >proteinsA ...
fasta R phylogenetic tree phylip ggtree written 1 day ago by Mike1.0k • updated 1 day ago by zx87544.8k
1
vote
7
answers
2.4k
views
7
answers
Answer: A: Where can I find public Single Cell RNA-seq data?
... There is one more database for single cell RNAseq: scRNASeqDB scRNASeqDB a database for gene expression profiling in human single cell by RNA-seq https://bioinfo.uth.edu/scrnaseqdb/ ...
written 25 days ago by Mike1.0k
0
votes
1
answer
144
views
1
answers
Answer: A: single cell RNA-seq pipeline
... Please have a look at following user friendly pipeline/ tools for single-cell RNA-seq data analysis... A step-by-step workflow for low-level analysis of single-cell RNA-seq data https://f1000research.com/articles/5-2122/v1 http://bioconductor.org/packages/devel/workflows/html/simpleSingleCell.ht ...
written 5 weeks ago by Mike1.0k
1
vote
1
answer
903
views
1
answers
Comment: C: Complex Heatmap: Changing order of clusters
... Thanks Kevin, this is very useful code. ...
written 4 months ago by Mike1.0k

Latest awards to Mike

Guru 25 days ago, received more than 100 upvotes.
Popular Question 5 weeks ago, created a question with more than 1,000 views. For clusterProfiler: Input file format
Popular Question 5 weeks ago, created a question with more than 1,000 views. For GSEA with TCGA data
Popular Question 4 months ago, created a question with more than 1,000 views. For clusterProfiler: Input file format
Popular Question 4 months ago, created a question with more than 1,000 views. For GSEA with TCGA data
Popular Question 6 months ago, created a question with more than 1,000 views. For clusterProfiler: Input file format
Popular Question 7 months ago, created a question with more than 1,000 views. For clusterProfiler: Input file format
Popular Question 8 months ago, created a question with more than 1,000 views. For clusterProfiler: Input file format
Popular Question 9 months ago, created a question with more than 1,000 views. For clusterProfiler: Input file format
Popular Question 9 months ago, created a question with more than 1,000 views. For GSEA with TCGA data
Popular Question 9 months ago, created a question with more than 1,000 views. For TCGA data: comparision in normal and tumor samples
Popular Question 9 months ago, created a question with more than 1,000 views. For GSVA analysis in R: How to use my geneset and expression data matrix in GSVA.
Student 9 months ago, asked a question with at least 3 up-votes. For Single Cell RNAseq data analysis protocol
Appreciated 10 months ago, created a post with more than 5 votes. For A: ChIP-seq. analysis Tutorial for Dummies
Good Question 10 months ago, asked a question that was upvoted at least 5 times. For Single Cell RNAseq data analysis protocol
Good Answer 10 months ago, created an answer that was upvoted at least 5 times. For A: ChIP-seq. analysis Tutorial for Dummies
Popular Question 10 months ago, created a question with more than 1,000 views. For HTSeq error when reading BAM file
Popular Question 10 months ago, created a question with more than 1,000 views. For clusterProfiler: Input file format
Popular Question 10 months ago, created a question with more than 1,000 views. For GSEA with TCGA data
Popular Question 11 months ago, created a question with more than 1,000 views. For HTSeq error when reading BAM file
Good Answer 11 months ago, created an answer that was upvoted at least 5 times. For A: ChIP-seq. analysis Tutorial for Dummies
Appreciated 11 months ago, created a post with more than 5 votes. For A: Single Cell RNAseq data analysis protocol
Teacher 11 months ago, created an answer with at least 3 up-votes. For C: Starting a career in Bioinformatics
Appreciated 13 months ago, created a post with more than 5 votes. For A: Single Cell RNAseq data analysis protocol
Popular Question 13 months ago, created a question with more than 1,000 views. For HTSeq error when reading BAM file

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 905 users visited in the last hour