Question: Blastp not returning results?
0
gravatar for cindyfang70
12 weeks ago by
cindyfang700 wrote:

Hi everyone! I am very new to both Python and Biopython and I am doing some protein sequencing work right now. Unfortunately, I have been having some trouble running BLAST searches with Biopython. I have been running the following code (Note: the third, super long parameter I'm using for qblast is the FASTA for prolactin that I found on NCBI.

import Bio
from Bio.Blast import NCBIWWW
from Bio.Blast import NCBIXML

result_handle = NCBIWWW.qblast("blastp","nt","""MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDK
RYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAI
LSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKI
DNYLKLLKCRIIHNNNC*""")
with open ("my_blast.xml" , "w") as out_handle :
    out_handle.write(result_handle.read())
result_handle.close
result_handle = open("my_blast.xml")
blast_record = NCBIXML.read(result_handle)

However, the XML file produced is the following:


http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
<BlastOutput>
  <BlastOutput_program>blastp</BlastOutput_program>
  <BlastOutput_version>BLASTP 2.8.0+</BlastOutput_version>
  <BlastOutput_reference>Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
  <BlastOutput_db>nt</BlastOutput_db>
  <BlastOutput_query-ID>Query_201655</BlastOutput_query-ID>
  <BlastOutput_query-def>unnamed protein product</BlastOutput_query-def>
  <BlastOutput_query-len>228</BlastOutput_query-len>
  <BlastOutput_param>
    <Parameters>
      <Parameters_matrix>BLOSUM62</Parameters_matrix>
      <Parameters_expect>10</Parameters_expect>
      <Parameters_gap-open>11</Parameters_gap-open>
      <Parameters_gap-extend>1</Parameters_gap-extend>
      <Parameters_filter>F</Parameters_filter>
    </Parameters>
  </BlastOutput_param>
<BlastOutput_iterations>
<Iteration>
  <Iteration_iter-num>1</Iteration_iter-num>
  <Iteration_query-ID>Query_201655</Iteration_query-ID>
  <Iteration_query-def>unnamed protein product</Iteration_query-def>
  <Iteration_query-len>228</Iteration_query-len>
<Iteration_hits>
</Iteration_hits>
  <Iteration_stat>
    <Statistics>
      <Statistics_db-num>0</Statistics_db-num>
      <Statistics_db-len>0</Statistics_db-len>
      <Statistics_hsp-len>0</Statistics_hsp-len>
      <Statistics_eff-space>0</Statistics_eff-space>
      <Statistics_kappa>-1</Statistics_kappa>
      <Statistics_lambda>-1</Statistics_lambda>
      <Statistics_entropy>-1</Statistics_entropy>
    </Statistics>
  </Iteration_stat>
</Iteration>
</BlastOutput_iterations>
</BlastOutput>

I'm not sure what exactly I'm doing wrong. Sorry if this is a dumb mistake, but please let me know what I can do to fix this problem!

ADD COMMENTlink modified 12 weeks ago by Biostar ♦♦ 20 • written 12 weeks ago by cindyfang700
1
gravatar for 5heikki
12 weeks ago by
5heikki7.8k
Finland
5heikki7.8k wrote:

You're attempting to blast a protein against a nucleotide (nt) database? Try replacing nt with nr..

ADD COMMENTlink written 12 weeks ago by 5heikki7.8k
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 718 users visited in the last hour