codeml.txt file isnot generating.
0
0
Entering edit mode
4 months ago

dear all I am analysing dn/ds of some protein sequences. I am running pal2nal.pl cluster_1.aln.faa nt_out.fasta -output paml -nogap > cluster_1.pal2nal

after that codeml

but after running codeml, i coud not find codeml.txt file. I have checked my files with example files of PAML but could not identify any error.

and python parse_codeml_output.py codeml.txt (This command is not running).

Can anybody tell me the problem.

INPUT file
    >core_1459_786_Org786_Gene1338
    MSQANATSLTLSSPTENKTSESGQLKEFRTPPHNLAIEQAVLAALMTVAESFEQVSDLLK
    ENDFYATRHKYIYRAIEKLAQENSPYDAVLVNDWLLKQNLLDAIGGEEYLMQLMADSPSS
    FYNLETYATKIKEFSTLRSMIKVSTEILQNAYDTKGRGVSEILDLAETSIFSLAEQHNNN
    KKDSGPKAISSVTADVISKLDELSKLDGNITGLTTGFLELDNKTSGMQPGDLIIVAARPS
    MGKTTFAMNLVESVLQYNKLPALVFSMEMPADSIAMRLISAMGKVHQGHLRSGNLDADEW
    TKVTGTILQLQQMHLYIDDSSALPPTEVRARARRIAKMHDGKIGCIMVDYLQLMKVPGMG
    DNRVGEISEISRSLKALAKEMNCPVIALSQLNRSLENRPNKRPVMSDLRESGAIEQDADL
    IMFIYRDEVYNKESKEAGTAEIIIGKQRNGPIGTVRLAFEGQYTRFSNLSPEYYSQYDDE
    E
    >core_1459_787_Org787_Gene2688
    MSQANATSLTLSSPTENKTSESGQLKEFRTPPHNLAIEQAVLAALMTVAESFEQVSDLLK
    ENDFYATRHKYIYRAIEKLAQENSPYDAVLVNDWLLKQNLLDAIGGEEYLMQLMADSPSS
    FYNLETYATKIKEFSTLRSMIKVSTEILQNAYDTKGRGVSEILDLAETSIFSLAEQHNNN
    KKDSGPKAISSVTADVISKLDELSKLDGNITGLTTGFLELDNKTSGMQPGDLIIVAARPS
    MGKTTFAMNLVESVLQYNKLPALVFSMEMPADSIAMRLISAMGKVHQGHLRSGNLDADEW
    TKVTGTILQLQQMHLYIDDSSALPPTEVRARARRIAKMHDGKIGCIMVDYLQLMKVPGMG
    DNRVGEISEISRSLKALAKEMNCPVIALSQLNRSLENRPNKRPVMSDLRESGAIEQDADL
    IMFIYRDEVYNKESKEAGTAEIIIGKQRNGPIGTVRLAFEGQYTRFSNLSPEYYSQYDDE
    E
    >core_1459_788_Org788_Gene2222
    MSQANATSLTLSSPTENKTSESGQLKEFRTPPHNLAIEQAVLAALMTVAESFEQVSDLLK
    ENDFYATRHKYIYRAIEKLAQENSPYDAVLVNDWLLKQNLLDAIGGEEYLMQLMADSPSS
    FYNLETYATKIKEFSTLRSMIKVSTEILQNAYDTKGRGVSEILDLAETSIFSLAEQHNNN
    KKDSGPKAISSVTADVISKLDELSKLDGNITGLTTGFLELDNKTSGMQPGDLIIVAARPS
    MGKTTFAMNLVESVLQYNKLPALVFSMEMPADSIAMRLISAMGKVHQGHLRSGNLDADEW
    TKVTGTILQLQQMHLYIDDSSALPPTEVRARARRIAKMHDGKIGCIMVDYLQLMKVPGMG
    DNRVGEISEISRSLKALAKEMNCPVIALSQLNRSLENRPNKRPVMSDLRESGAIEQDADL
    IMFIYRDEVYNKESKEAGTAEIIIGKQRNGPIGTVRLAFEGQYTRFSNLSPEYYSQYDDE

DNA file input: 
    >core_1459_786_Org786_Gene1338
    ATGTCACAAGCAAATGCAACTTCATTAACTTTATCATCACCAACTGAAAATAAAACTTCA
    GAATCAGGTCAATTAAAAGAATTTCGTACTCCACCACATAATTTAGCAATTGAACAAGCA
    GTTTTAGCAGCATTAATGACTGTTGCAGAATCATTTGAACAAGTTTCAGATTTATTAAAA
    GAAAATGATTTTTATGCAACTCGTCATAAATATATTTATCGTGCAATTGAAAAATTAGCA
    CAAGAAAATTCACCATATGATGCAGTTTTAGTTAATGATTGGTTATTAAAACAAAATTTA
    TTAGATGCAATTGGTGGTGAAGAATATTTAATGCAATTAATGGCAGATTCACCATCATCA
    TTTTATAATTTAGAAACTTATGCAACTAAAATTAAAGAATTTTCAACTTTACGTTCAATG
    ATTAAAGTTTCAACTGAAATTTTACAAAATGCATATGATACTAAAGGTCGTGGTGTTTCA
    GAAATTTTAGATTTAGCAGAAACTTCAATTTTTTCATTAGCAGAACAACATAATAATAAT
    AAAAAAGATTCAGGTCCAAAAGCAATTTCATCAGTTACTGCAGATGTTATTTCAAAATTA
    GATGAATTATCAAAATTAGATGGTAATATTACTGGTTTAACTACTGGTTTTTTAGAATTA
    GATAATAAAACTTCAGGTATGCAACCAGGTGATTTAATTATTGTTGCAGCACGTCCATCA
    ATGGGTAAAACTACTTTTGCAATGAATTTAGTTGAATCAGTTTTACAATATAATAAATTA
    CCAGCATTAGTTTTTTCAATGGAAATGCCAGCAGATTCAATTGCAATGCGTTTAATTTCA
    GCAATGGGTAAAGTTCATCAAGGTCATTTACGTTCAGGTAATTTAGATGCAGATGAATGG
    ACTAAAGTTACTGGTACTATTTTACAATTACAACAAATGCATTTATATATTGATGATTCA
    TCAGCATTACCACCAACTGAAGTTCGTGCACGTGCACGTCGTATTGCAAAAATGCATGAT
    GGTAAAATTGGTTGTATTATGGTTGATTATTTACAATTAATGAAAGTTCCAGGTATGGGT
    GATAATCGTGTTGGTGAAATTTCAGAAATTTCACGTTCATTAAAAGCATTAGCAAAAGAA
    ATGAATTGTCCAGTTATTGCATTATCACAATTAAATCGTTCATTAGAAAATCGTCCAAAT
    AAACGTCCAGTTATGTCAGATTTACGTGAATCAGGTGCAATTGAACAAGATGCAGATTTA
    ATTATGTTTATTTATCGTGATGAAGTTTATAATAAAGAATCAAAAGAAGCAGGTACTGCA
    GAAATTATTATTGGTAAACAACGTAATGGTCCAATTGGTACTGTTCGTTTAGCATTTGAA
    GGTCAATATACTCGTTTTTCAAATTTATCACCAGAATATTATTCACAATATGATGATGAA
    GAA
    >core_1459_787_Org787_Gene2688
    ATGTCACAAGCAAATGCAACTTCATTAACTTTATCATCACCAACTGAAAATAAAACTTCA
    GAATCAGGTCAATTAAAAGAATTTCGTACTCCACCACATAATTTAGCAATTGAACAAGCA
    GTTTTAGCAGCATTAATGACTGTTGCAGAATCATTTGAACAAGTTTCAGATTTATTAAAA
    GAAAATGATTTTTATGCAACTCGTCATAAATATATTTATCGTGCAATTGAAAAATTAGCA
    CAAGAAAATTCACCATATGATGCAGTTTTAGTTAATGATTGGTTATTAAAACAAAATTTA
    TTAGATGCAATTGGTGGTGAAGAATATTTAATGCAATTAATGGCAGATTCACCATCATCA
    TTTTATAATTTAGAAACTTATGCAACTAAAATTAAAGAATTTTCAACTTTACGTTCAATG
    ATTAAAGTTTCAACTGAAATTTTACAAAATGCATATGATACTAAAGGTCGTGGTGTTTCA
    GAAATTTTAGATTTAGCAGAAACTTCAATTTTTTCATTAGCAGAACAACATAATAATAAT
    AAAAAAGATTCAGGTCCAAAAGCAATTTCATCAGTTACTGCAGATGTTATTTCAAAATTA
    GATGAATTATCAAAATTAGATGGTAATATTACTGGTTTAACTACTGGTTTTTTAGAATTA
    GATAATAAAACTTCAGGTATGCAACCAGGTGATTTAATTATTGTTGCAGCACGTCCATCA
    ATGGGTAAAACTACTTTTGCAATGAATTTAGTTGAATCAGTTTTACAATATAATAAATTA
    CCAGCATTAGTTTTTTCAATGGAAATGCCAGCAGATTCAATTGCAATGCGTTTAATTTCA
    GCAATGGGTAAAGTTCATCAAGGTCATTTACGTTCAGGTAATTTAGATGCAGATGAATGG
    ACTAAAGTTACTGGTACTATTTTACAATTACAACAAATGCATTTATATATTGATGATTCA
    TCAGCATTACCACCAACTGAAGTTCGTGCACGTGCACGTCGTATTGCAAAAATGCATGAT
    GGTAAAATTGGTTGTATTATGGTTGATTATTTACAATTAATGAAAGTTCCAGGTATGGGT
    GATAATCGTGTTGGTGAAATTTCAGAAATTTCACGTTCATTAAAAGCATTAGCAAAAGAA
    ATGAATTGTCCAGTTATTGCATTATCACAATTAAATCGTTCATTAGAAAATCGTCCAAAT
    AAACGTCCAGTTATGTCAGATTTACGTGAATCAGGTGCAATTGAACAAGATGCAGATTTA
    ATTATGTTTATTTATCGTGATGAAGTTTATAATAAAGAATCAAAAGAAGCAGGTACTGCA
    GAAATTATTATTGGTAAACAACGTAATGGTCCAATTGGTACTGTTCGTTTAGCATTTGAA
    GGTCAATATACTCGTTTTTCAAATTTATCACCAGAATATTATTCACAATATGATGATGAA
    GAA
    >core_1459_788_Org788_Gene2222
    ATGTCACAAGCAAATGCAACTTCATTAACTTTATCATCACCAACTGAAAATAAAACTTCA
    GAATCAGGTCAATTAAAAGAATTTCGTACTCCACCACATAATTTAGCAATTGAACAAGCA
    GTTTTAGCAGCATTAATGACTGTTGCAGAATCATTTGAACAAGTTTCAGATTTATTAAAA
    GAAAATGATTTTTATGCAACTCGTCATAAATATATTTATCGTGCAATTGAAAAATTAGCA
    CAAGAAAATTCACCATATGATGCAGTTTTAGTTAATGATTGGTTATTAAAACAAAATTTA
    TTAGATGCAATTGGTGGTGAAGAATATTTAATGCAATTAATGGCAGATTCACCATCATCA
    TTTTATAATTTAGAAACTTATGCAACTAAAATTAAAGAATTTTCAACTTTACGTTCAATG
    ATTAAAGTTTCAACTGAAATTTTACAAAATGCATATGATACTAAAGGTCGTGGTGTTTCA
    GAAATTTTAGATTTAGCAGAAACTTCAATTTTTTCATTAGCAGAACAACATAATAATAAT
    AAAAAAGATTCAGGTCCAAAAGCAATTTCATCAGTTACTGCAGATGTTATTTCAAAATTA
    GATGAATTATCAAAATTAGATGGTAATATTACTGGTTTAACTACTGGTTTTTTAGAATTA
    GATAATAAAACTTCAGGTATGCAACCAGGTGATTTAATTATTGTTGCAGCACGTCCATCA
    ATGGGTAAAACTACTTTTGCAATGAATTTAGTTGAATCAGTTTTACAATATAATAAATTA
    CCAGCATTAGTTTTTTCAATGGAAATGCCAGCAGATTCAATTGCAATGCGTTTAATTTCA
    GCAATGGGTAAAGTTCATCAAGGTCATTTACGTTCAGGTAATTTAGATGCAGATGAATGG
    ACTAAAGTTACTGGTACTATTTTACAATTACAACAAATGCATTTATATATTGATGATTCA
    TCAGCATTACCACCAACTGAAGTTCGTGCACGTGCACGTCGTATTGCAAAAATGCATGAT
    GGTAAAATTGGTTGTATTATGGTTGATTATTTACAATTAATGAAAGTTCCAGGTATGGGT
    GATAATCGTGTTGGTGAAATTTCAGAAATTTCACGTTCATTAAAAGCATTAGCAAAAGAA
    ATGAATTGTCCAGTTATTGCATTATCACAATTAAATCGTTCATTAGAAAATCGTCCAAAT
    AAACGTCCAGTTATGTCAGATTTACGTGAATCAGGTGCAATTGAACAAGATGCAGATTTA
    ATTATGTTTATTTATCGTGATGAAGTTTATAATAAAGAATCAAAAGAAGCAGGTACTGCA
    GAAATTATTATTGGTAAACAACGTAATGGTCCAATTGGTACTGTTCGTTTAGCATTTGAA
    GGTCAATATACTCGTTTTTCAAATTTATCACCAGAATATTATTCACAATATGATGATGAA
    GAA
Codeml paml dn/ds • 110 views
ADD COMMENT

Login before adding your answer.

Traffic: 1824 users visited in the last hour
Help About
FAQ
Access RSS
API
Stats

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.

Powered by the version 2.3.6