Question: Amino Acid Composition-Graphic Representation
0
gravatar for williamjohn360
5.8 years ago by
Malaysia
williamjohn36090 wrote:

Is there any tool to create graphic representation of amino acid composition like in predictprotein.org? I understand it can be easily created in excel, but it will be good if any tool available online. enter image description here

ADD COMMENTlink modified 5.7 years ago by secretjess170 • written 5.8 years ago by williamjohn36090

You expect us to register at some site just so we might get an idea of what it is that you actually want to do?

ADD REPLYlink written 5.7 years ago by 5heikki8.5k

Now I have added the image

ADD REPLYlink written 5.7 years ago by williamjohn36090
3
gravatar for secretjess
5.7 years ago by
secretjess170
Cambridge
secretjess170 wrote:

In R:

rand_seq <- "WYEGYQERKMKKNLLGYEQMLRSDFMNTMHPHEDTWICWDYALNQIALNPKTWKVQKSCKASLMPTVDSMYFWYIAHMEMKMQYEWTEWFIHVPYFFDRCFVWYDEFCCQVCMAFLERFRDTNQSSGQLCAWVGYLKNIGYSHYISTILYRYPQEYNIVPTWNIAIMHMQDKVDVECKLNKSMSEHCHHHFPLLAYIDFPLWKPNIYKSPWLMDPFMANLA"

aa_tab <- table(strsplit(rand_seq,""))

pie(aa_tab, col=rainbow(length(aa_tab)), main="Amino Acid Composition")

Unless you didn't mean the pie chart, in which case I can't help, sorry!

simple pie chart

ADD COMMENTlink modified 5.7 years ago • written 5.7 years ago by secretjess170

Basically this but with ggplot2, which makes much prettier graphs IMO.

ADD REPLYlink written 5.7 years ago by 5heikki8.5k
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 658 users visited in the last hour