error when converting hmmer table to off table
1
0
Entering edit mode
2.4 years ago

Hello, I performed an alignment using hmmer hmmsearch tool using metagenomic contigs as a query and a hydrocarbon database (hydrocarbon.hmm file).

I n first instance I first retrieved all ORFs from the contigs and translated them with esl-translate program as following:

esl-translate -c 11 input_contigs.fa > translated_orfs.fa

After getting the translated ORFs under the translated_orfs.fa file, I run the alignment with hmmsearch

hmmsearch --domtblout dom_results.txt --cpu 10 hydrocarbon.hmm translated_orfs.fa > logfile.

Once I get the dom_results.txt file I proceed to use the hmmer2gff program as the following:

hmmer2gff -d -o gffs/sample1.gff tanslated_orfs.fa $i dom_Results.txt

But I'm getting the following error:

Traceback (most recent call last):   File "/Users/valentin-ignacio/opt/miniconda3/envs/mgkit/bin/hmmer2gff", line 11, in <module>
    sys.exit(main())   File "/Users/valentin-ignacio/opt/miniconda3/envs/mgkit/lib/python3.7/site-packages/mgkit/workflow/hmmer2gff.py", line 212, in main
    options   File "/Users/valentin-ignacio/opt/miniconda3/envs/mgkit/lib/python3.7/site-packages/mgkit/workflow/hmmer2gff.py", line 153, in parse_domain_table_contigs
    aa_seqs = get_aa_data(options.aa_file)   File "/Users/valentin-ignacio/opt/miniconda3/envs/mgkit/lib/python3.7/site-packages/mgkit/workflow/hmmer2gff.py", line 143, in get_aa_data
    for name, seq in fasta.load_fasta(f_handle)   File "/Users/valentin-ignacio/opt/miniconda3/envs/mgkit/lib/python3.7/site-packages/mgkit/workflow/hmmer2gff.py", line 142, in <genexpr>
    (name.split(' ')[0], seq)   File "/Users/valentin-ignacio/opt/miniconda3/envs/mgkit/lib/python3.7/site-packages/mgkit/io/fasta.py", line 41, in load_fasta
    line = line.decode('ascii') AttributeError: 'str' object has no attribute 'decode'

What can be happening here ?

This is the header of the aminoacidic fasta file:

>orf4 source=k141_332722 coords=96..221 length=42 frame=3 desc=flag=0 multi=8.4159 len=1747
PPQAIEQDFKYGIKAASLTTPSPTSEFIFNLFKLSQLQIKHS

Thanks for your time :)

Valentín.

hmmer2gff gff hmmer • 868 views
ADD COMMENT
1
Entering edit mode
2.4 years ago
Juke34 9.3k

Hmmr2gff code needs python2 apparently and you use python3

ADD COMMENT

Login before adding your answer.

Traffic: 2161 users visited in the last hour
Help About
FAQ
Access RSS
API
Stats

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.

Powered by the version 2.3.6