Problem using a custom blast database in tblastx
1
0
Entering edit mode
6.8 years ago
arronar ▴ 240

Hello.

I tried to create a custom DB for blast.

I downloaded fasta files from NCBI from an SRA project and then run this command

makeblastdb -dbtype nucl -in sra_data-DB.fasta -input_type fasta -out plant_Transcriptome_DB -title plant_Transcriptome_DB

and all seemed that went okey.

Building a new DB, current time: 06/18/2014 17:22:49
New DB name: plant_Transcriptome_DB
New DB title: plant_transcriptome_DB
Sequence type: Nucleotide
Keep Linkouts: T
Keep MBits: T
Maximum file size: 1000000000B
Adding sequences from FASTA; added 411965 sequences in 55.2244 seconds.

Three files created. (nhr,nin,nsq)

After this, i run a test with blastdbcmd to see if everything went right.

blastdbcmd -db plant_Transcriptome_DB.nsq -info

and returned me this:

Database: plant_transcriptome_DB
411,965 sequences; 107,369,081 total bases

Date: Jun 18, 2014  5:22 PM   Longest sequence: 999 bases

Volumes:  /*/*/*/*/*/*/*/plant_Transcriptome_DB

Ok! lets run tblastx and see what is happening:

tblastx -query contig2-query.fasta -db plant_Transcriptome_DB -out output -html

Returns :

Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 2: 6, 8, 13, 33, 43-44, 47-48, 50, 55-56, 58-59, 68-70, 72, 81
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 3: 7, 16, 18, 20-22, 26-28, 30, 35, 39, 41-43, 45, 47, 49, 54, 56-57, 59-60, 63-64, 66-67, 69, 71, 79-80, 83
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 4: 7-9, 14, 16, 18, 22, 25-27, 34, 36, 41-43, 45-46, 53-55, 57, 61, 65, 67, 70, 77, 80-81, 83
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 5: 1, 7, 9, 12, 14, 16, 21, 23, 25, 30, 36, 39, 41-42, 46, 51, 53, 57, 60, 67, 69-70, 73-74, 78-79, 81-82
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 6: 1-3, 17, 21, 29, 31, 34, 38-39, 42-43, 47, 53-55, 59, 61, 63, 65-66, 72, 74-77, 79-80
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 7: 1-2, 5-8, 12-13, 16, 18, 20, 23-28, 31, 34-35, 42-45, 52, 54, 60, 62, 67, 70-71, 75-76, 78
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 8: 1, 4-5, 8-9, 16, 19, 30-32, 36, 39-42, 48, 51-52, 56-57, 62-63, 67-69, 83
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 9: 1, 5-7, 12, 14, 17, 19-22, 24-25, 27-28, 30-31, 33, 36-40, 46-47, 50-51, 54, 57-59, 63, 65, 71, 73, 75, 80-81, 83
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 10: 2-3, 5, 7, 9, 15, 17, 25-26, 31, 34, 36-39, 42, 45-47, 50, 57, 62, 64, 69, 72, 76-78
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 11: 3, 7, 10, 12, 15, 17, 23-25, 31, 33, 36-37, 39-40, 42-43, 46-47, 49, 51, 54, 56, 61-62, 66-69, 71, 73, 76, 81
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 12: 4, 9, 11, 15-17, 20-21, 26-27, 29, 34-36, 38-39, 41, 43, 46, 53-55, 66-69, 76, 78, 81
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 13: 1, 12, 16, 25-26, 29, 31, 35, 38-39, 41, 49-50, 53, 56-57, 60-62, 64-66, 70, 72-73
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 14: 1-4, 7-8, 10-11, 13-14, 18, 21-22, 27, 30-31, 35, 37, 40-41, 45, 47-49, 52-53, 57, 64, 83
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 15: 2-3, 5, 7-9, 11, 13-16, 22-24, 28-29, 35-37, 40-41, 43-44, 49, 55, 60-61, 65, 67-69, 71, 75, 78, 83
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 16: 1-3, 8-12, 15-17, 21-22, 24-25, 27, 30, 32-33, 35, 40, 43, 45, 51-52, 56, 58-60, 64, 66-68, 71-72, 75, 81, 83
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 17: 2-3, 15-16, 19, 22, 25-26, 31, 35, 38, 47-48, 51, 53, 56-59, 62-64, 67, 70-71, 76, 78-79
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 18: 2-3, 6-8, 11, 13-14, 16, 18, 26, 28, 35, 40, 43, 46-47, 50-53, 55, 58-59, 67, 69, 74, 77, 81-82
Error: (1431.1) FASTA-Reader: Warning: FASTA-Reader: Ignoring invalid residues at position(s): On line 19: 2, 5, 7, 11, 15, 17, 20, 22, 27, 34, 37, 40-41, 43-45, 47, 49, 52, 54-55

Any idea?

Thank you.

blast software error • 8.4k views
ADD COMMENT
0
Entering edit mode

I'm seeing this same thing within the Blast2GO CLI pipeline, but I've provided the blastx binary, and I'm blasting a nucleotide fasta (transcriptome) against SWISS-PROT, which is protein (swissprot.pal, etc) ... was your problem resolved by the answer below, or did it turn out to be something else?

ADD REPLY
0
Entering edit mode

Hi all

i am getting also same error with blastx with custom db but when i run with swissprot output is generating

here i am attaching command that i have used

blastx -query ~/Transdecoder_out/Rio/longest_orfs.pep -db ~/blastdb/Sorghum_bicolor.Sorghum_bicolor_NCBIv3.pep -num_threads 8 -max_target_seqs 1 -outfmt 6 > Rio.outfmt6

Please someone guide

ADD REPLY
0
Entering edit mode

If you have peptide query sequences (looking at the file name) then you should be using blastp not blastx.

ADD REPLY
3
Entering edit mode
6.8 years ago
Ram 32k

Hi,

Could you maybe give us the first few lines of the query file? I think it might be a protein and not a nucleotide query, or it might have other invalid characters. The output of `head contig2-query.fasta` would help a lot.

Thank you!

ADD COMMENT
1
Entering edit mode

Yes you are right! It is a protein i should try with tblastn.

>gi|573913339|ref|XP_006644353.1| PREDICTED: probable pleiotropic drug resistance protein 2-like [Oryza brachyantha]
MDTAAEMQKVASLRRGGGGSSASMWWGADNGVFSRSRSSSMAEEDDEEALRWAALEKLPTYDRVRRAILPMEGGAAAGGGEGGAGGAGGEAGKRVVDVLSLGPQERRALLERLVRVAEDDNERFLLKLKERIDRVGIDIPTIEVRFEHLEAEAEVRVGNSGLPTVL

NSMTNKFEEAGNALGIVPNRKQTMPILHDVSGVIKPRRMTLLLGPPGSGKTTLLLALAGRLNKDLKFSGQVTYNGHQMDEFVP
QRTAAYISQHDLHIGEMTVRETLAFSARCQGVGTRFDMLTELSRREKAANIKPDADIDAFMKASAMEGQETNLITDYILKILG
LEICADTMVGDDMVRGISGGQRKRVTTGEMLVGPANALFMDEISTGLDSSTTFQIVKSLRQAIHILGGTAVISLLQPAPETYD
LFDDIILLSDGQIVYQGPREGVLEFFELMGFKCPERKGVADFLQEVTSKKDQKQYWMHHEKPYRYVPVKEFAGAFQSFHTGRS
IANELATPFDKSKSHPAALTTSRYGVSAMELLKANIDREFLLMKRNSFVYIFRTCQLMVVSLIAMTLFFRTKMHRDSVTDGVI
FMGALFFSVMMIMFNGLSELPLTIFKLPVFFKQRDLLFFPAWTYTIPTWILKTPMSFIEVGGFCFMSYYVIGFDPNVGRFFKQ
YLLMLAINQMAAAMFRFVGGAARNIIVANVFGSFMLLIFMVLGGFILVREKVKKWWIWGYWISPMMYAQNAISVNEFLGHSWV
ADD REPLY
0
Entering edit mode

You're welcome!

ADD REPLY

Login before adding your answer.

Traffic: 2158 users visited in the last hour
Help About
FAQ
Access RSS
API
Stats

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.

Powered by the version 2.3.6