Question: Command line blast database problem
0
gravatar for jolespin
4.6 years ago by
jolespin130
United States
jolespin130 wrote:

So I downloaded the ncbi blast suite and I'm trying to run the command line. 

I have a text file with a protein sequence at ~/in.txt:

MWLGLCLSLPPEFPGLDFTALCPLLQEAQPVWPCDLQVLESHS*

I used scp to copy the database files from my school [UCSC] server to my local drive in ~/blast_db

I ran the following command:

blastp -query ~/in.txt -out output_blast.txt -db /Users/Mu/blast_db/nr.32.psq

This is my error:

eduroam-16180339887:~ Mu$ blastp -db ~/blast_db/nr.32.psq -query ~/in.txt -out output_blast.txt

BLAST Database error: No alias or index file found for protein database [/Users/Mu/blast_db/nr.32.psq] in search path [/Users/Mu::]

The files are binary for the database.  I looked up the suffix on NCBI and .psq is what to use for protein database.   How can I get this to work? 

ADD COMMENTlink modified 4.6 years ago • written 4.6 years ago by jolespin130
2
gravatar for h.mon
4.6 years ago by
h.mon29k
Brazil
h.mon29k wrote:

I think your command-line should be:

blastp -query ~/in.txt -out output_blast.txt -db /Users/Mu/blast_db/nr.32

Do you have the other nr.32 files in addition to the .psq?

ADD COMMENTlink modified 4.6 years ago • written 4.6 years ago by h.mon29k

yes i do. woah it worked.  why didn't it work with ~/blast_db/nr.32.psq ?  ~ = /Users/Mu/

ADD REPLYlink written 4.6 years ago by jolespin130

because blast was looking for files "nr.32.psq.psq", "nr.32.psq.pni", etc.

ADD REPLYlink written 4.6 years ago by h.mon29k
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1239 users visited in the last hour