Question: Retrieve CDS sequence from XP accession number
0
gravatar for catarina.tserrano
12 months ago by
catarina.tserrano0 wrote:

Hi!!

I looking for a faster way to retrieve my CDS sequences from a list of protein accession numbers from NCBI. I know how to do it manually and one by one, but I need a quicker way to solve this problem.

Thank you CS

ncbi • 375 views
ADD COMMENTlink written 12 months ago by catarina.tserrano0

You can use NCBI eutils for batch retrieval. More info about this available on: https://www.ncbi.nlm.nih.gov/books/NBK179288/ and http://bioinformatics.cvr.ac.uk/blog/ncbi-entrez-direct-unix-e-utilities/

ADD REPLYlink written 12 months ago by Sej Modha4.6k
2
gravatar for genomax
12 months ago by
genomax80k
United States
genomax80k wrote:

Actual examples for @Sej' suggestion (output truncated to save space).

$ efetch -db nuccore -id "XP_001563456 " -format fasta_cds_na
>lcl|XM_001563406.1_cds_XP_001563456.1_1 [locus_tag=LBRM_15_0070] [db_xref=UniProtKB/TrEMBL:A4H7X7,GeneID:5413973] [protein=conserved hypothetical protein] [protein_id=XP_001563456.1] [location=1..1404] [gbkey=CDS]
ATGCCCTTGTCCTGCGTCGCCAAAGCTGAGGATGTCTTGCAGAAGACTGTGCATCTCTCCAGAGGCGGCC
TCTGCGCAGAGTTCACAGCGGAGGACATCCAGCGCATCACGGACGCCGACGTGCTCCGCTACCTCTCCAC
CCACTCTAATGCACGCACCGAATTGGACGGCGGTATCAACACCGCACCTGTTGAAAAGTCGCTCGCTCCT
GTGACGGGGGCGGCAGACATGGAGGTGCACATGGAGGCCTTGCAGGAGGCGATCAGCACATTTATTACAG

$ efetch -db nuccore -id "XP_001563456 " -format fasta_cds_aa
>lcl|XM_001563406.1_prot_XP_001563456.1_1 [locus_tag=LBRM_15_0070] [db_xref=UniProtKB/TrEMBL:A4H7X7,GeneID:5413973] [protein=conserved hypothetical protein] [protein_id=XP_001563456.1] [location=1..1404] [gbkey=CDS]
MPLSCVAKAEDVLQKTVHLSRGGLCAEFTAEDIQRITDADVLRYLSTHSNARTELDGGINTAPVEKSLAP
VTGAADMEVHMEALQEAISTFITVVDNEGCRYEIRVGALGHVQVPIDDDSYADGASLHEDEGDIEVAPAS
DAVHVGMSGEKSAVTEEATSAAVSRPSSEVTPAASHQKGWPVRRPQPSKPVRPARAAAHLSARVRQQNRF
ADD COMMENTlink modified 12 months ago • written 12 months ago by genomax80k
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 2276 users visited in the last hour