Question: NCBI's blastdbcmd Error: [blastdbcmd] Entry not found: TGME49_263070 Error: [blastdbcmd] Entry or entries not found in BLAST database
1
gravatar for beckyrjb6
4 weeks ago by
beckyrjb610
beckyrjb610 wrote:

Hi there,

Having some trouble with NCBI's blastdbcmd... I have made the database and can run blastp successfully. I would like to now get some fasta sequences using blastdbcmd. When I run: /PATH/ncbi-blast-2.9.0+/bin/blastdbcmd -entry all -db /PATH/Tgondii_r13 -out reference.fasta

It runs perfectly and generates a file with outputs like this in it:

 >TGME49_254250 | organism=Toxoplasma_gondii_ME49 | product=PRELI family protein | location=TGME49_chrIII:1559481-1562916(-) | length=480 | sequence_SO=chromosome | SO=protein_coding
MRLFEKTFVFDSDWETVTSAFWAKYPNELQPHVLRVDTLDVDIDPEKKEFATRRLHSLKYSVPRWMECFFGGSSPVGFGL
EEAYCSLPDKVLHLKSRNYTFASFFRVDEECTYTPDPTDPSRTVYKQTATYKVFGLGAAINRALERAAVRSAEEKSSVGF
SVVQSRASSLEQQGWWGRQCAACIHSLETAAASATQHYRDLVKNLEESLHLSLSPSSPLSSPLSLERLSPSPLVESSLFA
ACAMSASAKRFLSRPSPPFVLSRNDSSSLFSLNLPFGPLSLPSLPSSLKAFLPPSSSSPSSSSSPSSPPSPSSLSLSVNA
SPPERGVFRSSGDVDCFCLRPSPGGLLPRSTLEWNRTWREERENASRRRAAIRNDSAVSSTPEEEEGPRRTDSGSSTHGA

Now i am trying to search the command:

 /Users/PATH/ncbi-blast-2.9.0+/bin/blastdbcmd -entry TGME49_254250 -db /Users/PATH/Tgondii_r13 -out TGME49_254250.fasta

It flashes up the error: Error: [blastdbcmd] Entry not found: TGME49_254250 Error: [blastdbcmd] Entry or entries not found in BLAST database

Not sure what to do! Thank you in advance for any help!

blast • 152 views
ADD COMMENTlink modified 4 weeks ago by jrj.healey12k • written 4 weeks ago by beckyrjb610
3
gravatar for jrj.healey
4 weeks ago by
jrj.healey12k
United Kingdom
jrj.healey12k wrote:

Did you use -parseseqids when you built the database? (cant remember the exact argument syntax).

ADD COMMENTlink written 4 weeks ago by jrj.healey12k

Oh of course I completely forgot that! Thank you so much. Solved my problem :)

ADD REPLYlink written 4 weeks ago by beckyrjb610

Great, I've moved the post to an answer so you can accept it and provide closure to the thread :)

ADD REPLYlink written 4 weeks ago by jrj.healey12k

enter image description here

ADD REPLYlink written 4 weeks ago by ATpoint16k
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1082 users visited in the last hour