Extract mutations from fasta sequences
1
0
Entering edit mode
18 months ago

I have a large amount of align protein sequences in the .fasta forma, and a reference sequence, every of that has the same length. I would like to extract only the amino acid mutations from these sequences, so that, in the end, I want to have a list that looks something like this: I456L, W675T, etc . Is there a software or any way to do this? Thankful

Mutations fasta sequence • 758 views
ADD COMMENT
1
Entering edit mode

Pierre has a complete solution but in case that does not work you could use blastp with -outfmt 3 which will identify the difference and output it so.

Query_1    181  VAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARL  240
Subject_1  181  ..............................V.............................  240

Biopython blast parser may be able to help finish the rest.

ADD REPLY
4
Entering edit mode
18 months ago

Using bioalcidaejdk; http://lindenb.github.io/jvarkit/BioAlcidaeJdk.html and a fasta file where the very first sequence is the reference:

java -jar dist/bioalcidaejdk.jar -e 'FastaSequence ref=null; while(iter.hasNext()) { final FastaSequence seq = iter.next(); if(ref==null) { ref=seq; } else { for(int i=0;i< seq.length() && i< ref.length();i++) { char aa1 = ref.charAt(i); char aa2 = seq.charAt(i); if(aa1!=aa2) println(seq.getName()+"\t"+aa1+(i+1)+aa2); } } }'  input.fasta
ADD COMMENT
0
Entering edit mode

Pierre Lindenbaum I cannot find the fold dist, and bioalcidaejdk.jar too. There is a file named bioalcidaejdk.java in the bioalcidae folder.

ADD REPLY
0
Entering edit mode

Did you follow install instructions:

Requirements / Dependencies

java compiler SDK 11. Please check that this java is in the ${PATH}. Setting JAVA_HOME is not enough : (e.g: https://github.com/lindenb/jvarkit/issues/23 )

Download and Compile

$ git clone "https://github.com/lindenb/jvarkit.git"
$ cd jvarkit
$ ./gradlew bioalcidaejdk
ADD REPLY
0
Entering edit mode

Thank you both genomax and Pierre Lindenbaum. I had a problem with my JDK compiler, just solved it, i get running and everything went well!!!

ADD REPLY

Login before adding your answer.

Traffic: 1547 users visited in the last hour
Help About
FAQ
Access RSS
API
Stats

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.

Powered by the version 2.3.6