Question: Extract mutations from fasta sequences
0
gravatar for dasilvauirajan
10 weeks ago by
dasilvauirajan20 wrote:

I have a large amount of align protein sequences in the .fasta forma, and a reference sequence, every of that has the same length. I would like to extract only the amino acid mutations from these sequences, so that, in the end, I want to have a list that looks something like this: I456L, W675T, etc . Is there a software or any way to do this? Thankful

mutations sequence fasta • 172 views
ADD COMMENTlink modified 10 weeks ago by Pierre Lindenbaum128k • written 10 weeks ago by dasilvauirajan20
1

Pierre has a complete solution but in case that does not work you could use blastp with -outfmt 3 which will identify the difference and output it so.

Query_1    181  VAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARL  240
Subject_1  181  ..............................V.............................  240

Biopython blast parser may be able to help finish the rest.

ADD REPLYlink modified 10 weeks ago • written 10 weeks ago by genomax84k
3
gravatar for Pierre Lindenbaum
10 weeks ago by
France/Nantes/Institut du Thorax - INSERM UMR1087
Pierre Lindenbaum128k wrote:

Using bioalcidaejdk; http://lindenb.github.io/jvarkit/BioAlcidaeJdk.html and a fasta file where the very first sequence is the reference:

java -jar dist/bioalcidaejdk.jar -e 'FastaSequence ref=null; while(iter.hasNext()) { final FastaSequence seq = iter.next(); if(ref==null) { ref=seq; } else { for(int i=0;i< seq.length() && i< ref.length();i++) { char aa1 = ref.charAt(i); char aa2 = seq.charAt(i); if(aa1!=aa2) println(seq.getName()+"\t"+aa1+(i+1)+aa2); } } }'  input.fasta
ADD COMMENTlink written 10 weeks ago by Pierre Lindenbaum128k

Pierre Lindenbaum I cannot find the fold dist, and bioalcidaejdk.jar too. There is a file named bioalcidaejdk.java in the bioalcidae folder.

ADD REPLYlink modified 7 weeks ago • written 7 weeks ago by dasilvauirajan20

Did you follow install instructions:

Requirements / Dependencies

java compiler SDK 11. Please check that this java is in the ${PATH}. Setting JAVA_HOME is not enough : (e.g: https://github.com/lindenb/jvarkit/issues/23 )

Download and Compile

$ git clone "https://github.com/lindenb/jvarkit.git"
$ cd jvarkit
$ ./gradlew bioalcidaejdk
ADD REPLYlink modified 7 weeks ago • written 7 weeks ago by genomax84k

Thank you both genomax and Pierre Lindenbaum. I had a problem with my JDK compiler, just solved it, i get running and everything went well!!!

ADD REPLYlink written 7 weeks ago by dasilvauirajan20
Please log in to add an answer.

Help
Access

Use of this site constitutes acceptance of our User Agreement and Privacy Policy.
Powered by Biostar version 2.3.0
Traffic: 1760 users visited in the last hour